Scaffold Ga0211705_10023979

Overview

Basic Information

• Taxon OID: 3300020395
• Scaffold ID: Ga0211705_10023979
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2224
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_072
• Coordinates
  • Lat. (^o): -8.7006
  • Long. (^o): -17.9915
  • Depth (m): 100

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084708	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211705_100239795	F084708	GAGG	MNSINQSKVDDELKKLAMDYIKATNADDLSTAETILHNMEELKKLTHD