Scaffold Ga0211678_10039428

Overview

Basic Information

• Taxon OID: 3300020388
• Scaffold ID: Ga0211678_10039428
• Source Dataset Name: Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: CEA Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2284
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: TARA_093
• Coordinates
  • Lat. (^o): -33.8785
  • Long. (^o): -73.0369
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051974	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211678_100394281	F051974	GAG	MLINNQGNYLNKSETDVELEILFIASPIRPEIGKTSIFLTF