NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206124_10382512

Scaffold Ga0206124_10382512


Overview

Basic Information
Taxon OID3300020175 Open in IMG/M
Scaffold IDGa0206124_10382512 Open in IMG/M
Source Dataset NamePelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)526
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameAtlantic Ocean: North Sea, Helgoland
CoordinatesLat. (o)54.1841Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011096Metagenome / Metatranscriptome295Y
F085894Metagenome / Metatranscriptome111Y
F090410Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0206124_103825121F090410AGTAGMSKPTPAWVGQYTAFNDALKYMYARSTGDEKSIYTP
Ga0206124_103825122F085894GAGMTSDKITKVLNKLNQVLEDFQMLRDGTWVPDESSCEASIENVESIIYTVENE
Ga0206124_103825123F011096N/ARNNVKALGEAFRWFFETYDHTWDEVHEATRMYVNEYRDAGYMYMQTSQYFICKQDKHRVKHSTLADYCDMIVEGVSTEDEHFKERVV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.