Basic Information | |
---|---|
Family ID | F090410 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 108 |
Average Sequence Length | 43 residues |
Representative Sequence | MSKPTESWTGQYAAFNEALKYMYARQKGEEKSIYTPWPKFNDAA |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 25.00 % |
% of genes near scaffold ends (potentially truncated) | 95.37 % |
% of genes from short scaffolds (< 2000 bps) | 87.96 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.963 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (23.148 % of family members) |
Environment Ontology (ENVO) | Unclassified (61.111 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (67.593 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.72% β-sheet: 0.00% Coil/Unstructured: 65.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF08299 | Bac_DnaA_C | 15.74 |
PF03167 | UDG | 10.19 |
PF00149 | Metallophos | 0.93 |
PF00871 | Acetate_kinase | 0.93 |
PF01832 | Glucosaminidase | 0.93 |
PF03819 | MazG | 0.93 |
PF00271 | Helicase_C | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 15.74 |
COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 10.19 |
COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 10.19 |
COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 10.19 |
COG0282 | Acetate kinase | Energy production and conversion [C] | 0.93 |
COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.37 % |
Unclassified | root | N/A | 4.63 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000973|BBAY93_10127255 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 644 | Open in IMG/M |
3300001213|JGIcombinedJ13530_108329954 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 968 | Open in IMG/M |
3300001344|JGI20152J14361_10062051 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 903 | Open in IMG/M |
3300001934|GOS2267_101705 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
3300002488|JGI25128J35275_1088496 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 631 | Open in IMG/M |
3300003270|JGI26113J46593_1028111 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 613 | Open in IMG/M |
3300004113|Ga0065183_10791319 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 505 | Open in IMG/M |
3300006425|Ga0075486_1826406 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 794 | Open in IMG/M |
3300006734|Ga0098073_1023350 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 910 | Open in IMG/M |
3300006737|Ga0098037_1213481 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 628 | Open in IMG/M |
3300006750|Ga0098058_1199877 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 520 | Open in IMG/M |
3300006752|Ga0098048_1133010 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 745 | Open in IMG/M |
3300006790|Ga0098074_1017114 | All Organisms → Viruses → Predicted Viral | 2236 | Open in IMG/M |
3300006924|Ga0098051_1147127 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 623 | Open in IMG/M |
3300006929|Ga0098036_1041036 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1444 | Open in IMG/M |
3300006947|Ga0075444_10304083 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 615 | Open in IMG/M |
3300007540|Ga0099847_1103082 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 868 | Open in IMG/M |
3300007559|Ga0102828_1164598 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 560 | Open in IMG/M |
3300007667|Ga0102910_1017240 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1620 | Open in IMG/M |
3300008470|Ga0115371_10289923 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1338 | Open in IMG/M |
3300009135|Ga0118736_10183777 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 638 | Open in IMG/M |
3300009172|Ga0114995_10838495 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 504 | Open in IMG/M |
3300009425|Ga0114997_10574318 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 596 | Open in IMG/M |
3300009428|Ga0114915_1183173 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 582 | Open in IMG/M |
3300009432|Ga0115005_10665697 | Not Available | 835 | Open in IMG/M |
3300009512|Ga0115003_10613753 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 634 | Open in IMG/M |
3300009593|Ga0115011_10578767 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 902 | Open in IMG/M |
3300009593|Ga0115011_11001789 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 707 | Open in IMG/M |
3300009786|Ga0114999_10780885 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 707 | Open in IMG/M |
3300010149|Ga0098049_1263468 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 523 | Open in IMG/M |
3300010153|Ga0098059_1158774 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 889 | Open in IMG/M |
3300010153|Ga0098059_1329576 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 581 | Open in IMG/M |
3300010392|Ga0118731_114935307 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1401 | Open in IMG/M |
3300011013|Ga0114934_10542924 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 513 | Open in IMG/M |
3300011268|Ga0151620_1164362 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 679 | Open in IMG/M |
3300012954|Ga0163111_10162000 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1903 | Open in IMG/M |
3300013101|Ga0164313_10571893 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 937 | Open in IMG/M |
3300017713|Ga0181391_1096790 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 668 | Open in IMG/M |
3300017742|Ga0181399_1036223 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1322 | Open in IMG/M |
3300017744|Ga0181397_1112865 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 709 | Open in IMG/M |
3300017744|Ga0181397_1115299 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 700 | Open in IMG/M |
3300017762|Ga0181422_1141411 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 740 | Open in IMG/M |
3300017763|Ga0181410_1130679 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 713 | Open in IMG/M |
3300017768|Ga0187220_1179442 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 639 | Open in IMG/M |
3300017769|Ga0187221_1077160 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1038 | Open in IMG/M |
3300017772|Ga0181430_1151413 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 674 | Open in IMG/M |
3300017782|Ga0181380_1232270 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 614 | Open in IMG/M |
3300017782|Ga0181380_1254359 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 582 | Open in IMG/M |
3300017952|Ga0181583_10735769 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 584 | Open in IMG/M |
3300017956|Ga0181580_10126117 | All Organisms → Viruses → Predicted Viral | 1853 | Open in IMG/M |
3300017967|Ga0181590_10144523 | All Organisms → Viruses → Predicted Viral | 1825 | Open in IMG/M |
3300020175|Ga0206124_10382512 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 526 | Open in IMG/M |
3300020182|Ga0206129_10000164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 114890 | Open in IMG/M |
3300020410|Ga0211699_10273616 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 655 | Open in IMG/M |
3300020430|Ga0211622_10254350 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 752 | Open in IMG/M |
3300020438|Ga0211576_10611414 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 541 | Open in IMG/M |
3300020452|Ga0211545_10119982 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1231 | Open in IMG/M |
3300021368|Ga0213860_10404561 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 590 | Open in IMG/M |
3300022057|Ga0212025_1029076 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 926 | Open in IMG/M |
3300022187|Ga0196899_1162211 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 614 | Open in IMG/M |
3300022308|Ga0224504_10457219 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 532 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10005892 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 3469 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10062717 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1166 | Open in IMG/M |
3300023116|Ga0255751_10080439 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2096 | Open in IMG/M |
3300023170|Ga0255761_10576746 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 514 | Open in IMG/M |
3300023172|Ga0255766_10141289 | All Organisms → Viruses → Predicted Viral | 1387 | Open in IMG/M |
3300024229|Ga0233402_1024198 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1325 | Open in IMG/M |
3300024328|Ga0228635_1048271 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1151 | Open in IMG/M |
(restricted) 3300024528|Ga0255045_10206741 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 767 | Open in IMG/M |
3300024555|Ga0255280_1043096 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 931 | Open in IMG/M |
3300025057|Ga0208018_116739 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 908 | Open in IMG/M |
3300025097|Ga0208010_1112906 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 550 | Open in IMG/M |
3300025110|Ga0208158_1077069 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 797 | Open in IMG/M |
3300025647|Ga0208160_1078958 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 885 | Open in IMG/M |
3300025873|Ga0209757_10210935 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 615 | Open in IMG/M |
3300026203|Ga0207985_1129348 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 583 | Open in IMG/M |
3300027631|Ga0208133_1005031 | All Organisms → cellular organisms → Bacteria | 3956 | Open in IMG/M |
3300027631|Ga0208133_1165363 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 509 | Open in IMG/M |
3300027736|Ga0209190_1170035 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 925 | Open in IMG/M |
3300027742|Ga0209121_10182147 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 771 | Open in IMG/M |
3300027780|Ga0209502_10429906 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 533 | Open in IMG/M |
3300027791|Ga0209830_10247267 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 811 | Open in IMG/M |
3300027791|Ga0209830_10418823 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 566 | Open in IMG/M |
3300027858|Ga0209013_10227817 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1107 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10027566 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2289 | Open in IMG/M |
3300027978|Ga0209165_10164486 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 768 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10024250 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2268 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10041825 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1754 | Open in IMG/M |
3300028136|Ga0228608_1039553 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1381 | Open in IMG/M |
3300031167|Ga0308023_1063668 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 698 | Open in IMG/M |
3300031566|Ga0307378_10157886 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2278 | Open in IMG/M |
3300031566|Ga0307378_10347073 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1383 | Open in IMG/M |
3300031566|Ga0307378_10859767 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 756 | Open in IMG/M |
3300031578|Ga0307376_10211530 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1320 | Open in IMG/M |
3300031602|Ga0307993_1104999 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 711 | Open in IMG/M |
3300031659|Ga0307986_10147555 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
3300031688|Ga0308011_10186838 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 625 | Open in IMG/M |
3300031703|Ga0308002_1065172 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 808 | Open in IMG/M |
3300031851|Ga0315320_10495723 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 825 | Open in IMG/M |
3300032212|Ga0316207_10030258 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 3192 | Open in IMG/M |
3300032373|Ga0316204_10651518 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 768 | Open in IMG/M |
3300033742|Ga0314858_009827 | All Organisms → Viruses → Predicted Viral | 1901 | Open in IMG/M |
3300033742|Ga0314858_199820 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 513 | Open in IMG/M |
3300034105|Ga0335035_0694174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 | 523 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 23.15% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.11% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.48% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.48% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.56% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.63% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.63% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.70% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.70% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.85% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.85% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.85% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.85% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.85% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.85% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.85% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.85% |
Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 1.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.93% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.93% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.93% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.93% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.93% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.93% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.93% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.93% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.93% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.93% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.93% |
Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 0.93% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
3300001934 | Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858 | Environmental | Open in IMG/M |
3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
3300003270 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_17_M020 | Environmental | Open in IMG/M |
3300004113 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2) | Environmental | Open in IMG/M |
3300006425 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
3300009135 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf | Environmental | Open in IMG/M |
3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
3300024328 | Seawater microbial communities from Monterey Bay, California, United States - 44D | Environmental | Open in IMG/M |
3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
3300024555 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
3300026203 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027742 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
3300028136 | Seawater microbial communities from Monterey Bay, California, United States - 9D | Environmental | Open in IMG/M |
3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
3300031688 | Marine microbial communities from water near the shore, Antarctic Ocean - #177 | Environmental | Open in IMG/M |
3300031703 | Marine microbial communities from water near the shore, Antarctic Ocean - #34 | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
3300032212 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-week pyrite | Environmental | Open in IMG/M |
3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
BBAY93_101272551 | 3300000973 | Macroalgal Surface | MTKIKPAWDGQYQSFNEALKYMLARQSGKEKSIQTPWPKFNDAITDGLEWN |
JGIcombinedJ13530_1083299543 | 3300001213 | Wetland | MSKPEKAWNGQYASFNEALKYMQKRAAGQEKSIYTP |
JGI20152J14361_100620511 | 3300001344 | Pelagic Marine | MAKPTEGWVGQYAAFNEALKYMQGRQNGTEKSIYTPWPKFN |
GOS2267_1017053 | 3300001934 | Marine | MSRPKPAWVGQYEAFNDALKYMYARSKGDEKSIFTPWPKFN |
JGI25128J35275_10884962 | 3300002488 | Marine | MSKKAWDGQYQSFNEALRYMLDRQSGKEKSIYTPWSKFNDAVTDGL |
JGI26113J46593_10281112 | 3300003270 | Marine | MGKPTPAWVGQYTAFNDALKYMYARSTGEEKSIYTPWPKFNDAATDGLEWNT |
Ga0065183_107913192 | 3300004113 | Pelagic Marine | MGKTDKSWVGQHAAFSEALKYMNARQKGEEKSIYTPWPKFNDAATDGLE |
Ga0075486_18264063 | 3300006425 | Aqueous | MSKFQKAWAGQYNAFNEALKYMQKRQTGEEKSIYTPW |
Ga0098073_10233503 | 3300006734 | Marine | MSKPEEAWVGQYAAFNDALKYMYKRANGEEKSIYTPW |
Ga0098037_12134813 | 3300006737 | Marine | MSKKSEPSWEGQYAAFNEALKYMYKRQTGEEKSIYTPWPKFNDATTDG |
Ga0098058_11998772 | 3300006750 | Marine | MKEEWQSQHIDFNEALKYMKRRQQGIEKSIYTPWPKFND |
Ga0098048_11330101 | 3300006752 | Marine | MSKVKPAWDGQYQSFNEALKYMLARQSGKEKSIQTPWPK |
Ga0098074_10171146 | 3300006790 | Marine | MKEAWHGQYQSFNEALKYMLDRQSGKEKSIQTPWPKFNDAVTDG |
Ga0098051_11471271 | 3300006924 | Marine | MSKAWHGQHTAFQEALRYMLDRQSGKEKSIYTPWHKFNDAVTDGL |
Ga0098036_10410364 | 3300006929 | Marine | MSKIKPAWDGQYQAFNEALKYMLARQNGTEKSIQTPWPKFNDAVTDGLEWNT |
Ga0075444_103040832 | 3300006947 | Marine | MTDKKAWGGQYTAFNEALKYMLDRQSGKEKSIQTPWPKFNDAITDGLEWNTLT |
Ga0070753_13615473 | 3300007346 | Aqueous | MQIKHEWQSQHVDYNEALKYMKRRQEGTEKSIYTPWPKFNDAA |
Ga0099847_11030823 | 3300007540 | Aqueous | MSKTKESWAGQHTAFNEALKYMFRRSTGEEKSIYTPWPKFND |
Ga0102828_11645983 | 3300007559 | Estuarine | MSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYTP |
Ga0102910_10172401 | 3300007667 | Estuarine | MKKTSEAWVGQYAAFNEALKYMYRRSTGEEKSIYTPWPKFNDA |
Ga0115371_102899231 | 3300008470 | Sediment | MSKTNKSWVGQHAAFSEALKYMNARQKGEEKSIYTPWPKFN |
Ga0118736_101837771 | 3300009135 | Marine Sediment | MKKTSEAWVGQYAAFNEALKYMYARSTGEEKSIYTPWPK |
Ga0114995_108384951 | 3300009172 | Marine | MKKTSEAWVGQYAAFNEALKYMFKRSTGEEKSIYTPWPKFNDAATDGL |
Ga0114997_105743181 | 3300009425 | Marine | MSNKEWGGQYGSFNEALKYMLDRQSGKEKSIQTPWPKFNDAITDGLEWNT |
Ga0114915_11831732 | 3300009428 | Deep Ocean | MSKPTPAWVGQYTAFNDALKYMYARSTGDEKSIYTPWPKFNDAATDGLEWN |
Ga0115005_106656975 | 3300009432 | Marine | MSKPTPAWVGQYTAFNDALKYMYARSTGAEKSIYTPWPKFN |
Ga0115003_106137532 | 3300009512 | Marine | MSKPTEGWVGQYAAFNEALKYMQGRQNGTEKSIYTPWPKFNDAATDGLEWNTL |
Ga0115011_105787673 | 3300009593 | Marine | MSKVKPAWDGQYQSFNEALKYMLARQSGKEKSIQTPWPKFNDAVTDGLEW |
Ga0115011_110017891 | 3300009593 | Marine | MKAEKAWVGKHGSFNEALKYMQRRQQGIEKSIYTPWPKFNDAATDGLEWNT |
Ga0114999_107808852 | 3300009786 | Marine | MKKTSEAWVGQYAAFNEALKYMFKRSTGEEKSIYTPWP |
Ga0098049_12634683 | 3300010149 | Marine | MSKVKEEWIGQFSAFNEALKYMSKRANGEEKSIYTPWAKFNDATTDGL |
Ga0098059_11587743 | 3300010153 | Marine | MSTVKPAWDGQYQAFNDALKYMLARQSGKEKSIQTPWPKFNDAITDG |
Ga0098059_13295761 | 3300010153 | Marine | MSKVKPAWDGQYQAFNEALKYMLARQSGQEKSIQTPWPKF |
Ga0118731_1149353074 | 3300010392 | Marine | MGKTDKSWVGQHAAFSEALKYMNARQKGEEKSIYTPWPKFNDAA |
Ga0114934_105429242 | 3300011013 | Deep Subsurface | MSKAWNGQYQSFNEALKYMLDRQSGKEKSIQTPWPKFNDAVTD |
Ga0151620_11643622 | 3300011268 | Freshwater | MSKPEKAWNGQYASFNEALKYMQKRAAGQEKSIYTPWPKFNDATTDGLEWNTLTV |
Ga0163111_101620001 | 3300012954 | Surface Seawater | MKKKPSWVGQYAAFNEALKYMYARSTGEEKSIYTPWP |
Ga0164313_105718933 | 3300013101 | Marine Sediment | MSKPKPAWVGQYQAFNDALKYMYARSTGEEKSIYTP |
Ga0181391_10967903 | 3300017713 | Seawater | MSKAQKAWAGQYQAFNEALKYMNNRMHGEERSILTPWSKFND |
Ga0181399_10362231 | 3300017742 | Seawater | MSKAQKAWAGQYQAFNEALKYMNNRMHGEERSILTPWSKFNDAGTDGIE |
Ga0181397_11128652 | 3300017744 | Seawater | MKKTSEAWVGQYAAFNEALKYMFKRSTGEEKSIYTPWPKFNDAATDGIEWNT |
Ga0181397_11152991 | 3300017744 | Seawater | MKNKPSWIGQYAAFNEALKYMYARSTGEEKSIYTPWPKF |
Ga0181422_11414112 | 3300017762 | Seawater | MGKPTPAWVGQYTAFNDALKYMYARSTGEEKSIYTPWPKFN |
Ga0181410_11306792 | 3300017763 | Seawater | MSDNAWGGQYTAFNEALKYMLDRQSGKEKSIQTPWPKFND |
Ga0187220_11794422 | 3300017768 | Seawater | MSNKAWNGQYQSFNEALKYMLDRQSGKEKSIYTPWPKFNDAVTDGL |
Ga0187221_10771601 | 3300017769 | Seawater | MSKAQKAWAGQYQAFNEALKYMNNRMHGEERSILTPC |
Ga0181430_11514132 | 3300017772 | Seawater | MSNDKLWNGQYTAFNEALKYMLDRQSGKEKSIQTP |
Ga0181380_12322702 | 3300017782 | Seawater | MKKTSEAWVGQYAAFNEALKYMYRRSTGEEKSIYTPWP |
Ga0181380_12543591 | 3300017782 | Seawater | MSKVDKAWDGQYTAFNEALKYMHNRQQGKEKSVLTPWPKFNDAATD |
Ga0181583_107357693 | 3300017952 | Salt Marsh | MSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWP |
Ga0181580_101261171 | 3300017956 | Salt Marsh | MSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWPKFNDATTDGLEWNTLTV |
Ga0181590_101445235 | 3300017967 | Salt Marsh | MSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWPKFNDATTDGL |
Ga0181585_105153761 | 3300017969 | Salt Marsh | MQVKKEWQSQNIDFNDALNYMKRRQEGTEKSIYTPWPKFNDAGTDG |
Ga0206124_103825121 | 3300020175 | Seawater | MSKPTPAWVGQYTAFNDALKYMYARSTGDEKSIYTP |
Ga0206129_100001641 | 3300020182 | Seawater | MSKPTPAWVGQYTAFNDALKYMYARSTGDEKSIYTPWPKFND |
Ga0211699_102736161 | 3300020410 | Marine | MSKIKPAWDGQYQAFNEALKYMLARQSGKEKSIQT |
Ga0211622_102543502 | 3300020430 | Marine | MSKKPAWNGQYESFNEALKYMFQRQSGEEKSIYTPWPKFNDATTDGLEWNTLTV |
Ga0211576_106114141 | 3300020438 | Marine | MSDNAWGGQYTAFNEALKYMLDRQSGKEKSIQTPWPKFNDAITDGLEWNTLTV |
Ga0211545_101199823 | 3300020452 | Marine | MKKKESWVGQYAAFNEALKYMYARSTGEEKSIYTPWPK |
Ga0213860_104045612 | 3300021368 | Seawater | MSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWPKFNDATTDG |
Ga0212025_10290761 | 3300022057 | Aqueous | MSNIEQAWNGQHTAFQDALKYMLNRQTGKEKSIYTPWPKFNDATTDGLEWNS |
Ga0212026_10398623 | 3300022069 | Aqueous | MQRKHEWQSQHVDYNEALKYMKRRQEGTEKSIYTPWPK |
Ga0196899_11622111 | 3300022187 | Aqueous | MSKPTPGWGGQFSAFKEALKYMSARQSGEEKSIYTPWPKFN |
Ga0224504_104572192 | 3300022308 | Sediment | MSKAQEEWAGQYTAFNEALKYMTKRANGEEKSIYTPWAKFNDATTDGLEWNT |
(restricted) Ga0233411_100058921 | 3300023112 | Seawater | MSRPTEGWVGQYAAFNEALKYMQGRQNGTEKSIYTPWPKFNDAATDGL |
(restricted) Ga0233411_100627171 | 3300023112 | Seawater | MSKTKKHWEGQYDSFNVALKYMLDRQTGIEKSIFTPWHKFNDAG |
Ga0255751_100804391 | 3300023116 | Salt Marsh | MSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWPKFNDATTDGLEW |
Ga0255761_105767461 | 3300023170 | Salt Marsh | MSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWPKFND |
Ga0255766_101412891 | 3300023172 | Salt Marsh | MSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYT |
Ga0233402_10241984 | 3300024229 | Seawater | MSKTKESWSGQHTAFNEALKYMFRRSTGEEKSIYTPWPKFNDATTDGLEWNTLTV |
Ga0228635_10482711 | 3300024328 | Seawater | MGKPTPAWVGQYTAFNDALKYMYARSTGEEKSIYTPWPKFNDAATDG |
(restricted) Ga0255045_102067412 | 3300024528 | Seawater | MKKTSEAWVGQYAAFNEALKYMYRRSTGEEKSIYTPWPKFNDAA |
Ga0255280_10430961 | 3300024555 | Freshwater | MSKPEKAWNGQYASFNEALKYMQKRAAGQEKSIYTPWPKFND |
Ga0208018_1167393 | 3300025057 | Marine | MSKPEEAWVGQYAAFNDALKYMYKRANGEEKSIYTP |
Ga0208010_11129061 | 3300025097 | Marine | MNKLKPQWGGQYQNFNDALKYMLDRQNGDEKSIFTPWPKFNDAGTDGLEWNTLT |
Ga0208158_10770692 | 3300025110 | Marine | MSKIKPAWDGQYQSFNEALKYMLARQSGKEKSIQTPWPKFNDAITDGLEWN |
Ga0208160_10789581 | 3300025647 | Aqueous | MSKPTESWIGQYAAFNDALKYMHARSVGEEKSIYTPWPKFNDAT |
Ga0209757_102109351 | 3300025873 | Marine | MSKVKPAWDGQYQAFNEALKYMLARQSGKEKSIQTPWPKFND |
Ga0207985_11293482 | 3300026203 | Marine | MSKTNDAWIGQYAAFNEALKYMYKRSTGEEKSIYTPWPKFNDATTDG |
Ga0208133_100503111 | 3300027631 | Estuarine | MSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYT |
Ga0208133_11653631 | 3300027631 | Estuarine | MSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYTPWPKFNDATTDGLEW |
Ga0209190_11700351 | 3300027736 | Freshwater Lake | MSKPTESWIGQYAAFNDALKYMYKRQTGEEKSIYTPWPK |
Ga0209121_101821471 | 3300027742 | Marine | MKKTSEAWVGQYAAFNEALKYMYRRSTGEEKSIYTPWPKFN |
Ga0209502_104299061 | 3300027780 | Marine | MSKSTGAWIGQFAAFNEALKYMYARQKGEEKSIYTPWPKFNDAA |
Ga0209830_102472671 | 3300027791 | Marine | MSNEKPWNGQYTAFNEALKYMLDRQSGKEKSIQTPWLK |
Ga0209830_104188233 | 3300027791 | Marine | MGKTDKSWVGQHAAFSEALKYMSARSKGEEKSIYTPWPKFNDAATDGLEWN |
Ga0209013_102278173 | 3300027858 | Marine | MKKKESWIGQYAAFNEALKYMHARSTGDEKSIYTPWPKFNDAATD |
(restricted) Ga0233415_100275665 | 3300027861 | Seawater | MSNKSGSWVGQYAAFNEALKYMYARQKGEEKSIYTPW |
Ga0209165_101644861 | 3300027978 | Marine Sediment | MSKTKESWVGQYTAFNEALKYMFRRSTGEEKSIYTPWPKFN |
(restricted) Ga0233413_100242501 | 3300027996 | Seawater | MSKPTPAWVGQYTAFNDALKYMYARSTGDEKSIYTPWPKFNDAATDGLE |
(restricted) Ga0233413_100418255 | 3300027996 | Seawater | MWNGQHTAFQEALRYMLDRQSGKEKSIYTPWPKFNDAITDGLEWN |
Ga0228608_10395534 | 3300028136 | Seawater | MSKTKESWSGQHTAFNEALKYMFRRSTGEEKSIYTPWPKFN |
Ga0308023_10636681 | 3300031167 | Marine | MGKTENAWVGQYSNFNEALKYMLARSNGEEKSIYTPWPKFNDAATD |
Ga0307378_101578861 | 3300031566 | Soil | MSKATEAWIGQYAAFNEALKYMRGRQNGTEKSIYTPW |
Ga0307378_103470731 | 3300031566 | Soil | MSRQKPAWGGQNESFNEALKYMLNRQKGLEKSIYT |
Ga0307378_108597673 | 3300031566 | Soil | MSRPKPAWVGQYEAFNDALKYMYARSTGDEKSIYTPWPKFNDACTDGLE |
Ga0307376_102115305 | 3300031578 | Soil | MSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYTPWPK |
Ga0307993_11049991 | 3300031602 | Marine | MSKPQESWVGQHAAFSEALKYMNARQKGEEKSIYTPWPKFNDAATD |
Ga0307986_101475554 | 3300031659 | Marine | MSRPTEEWVGQYAAFNEALKYMKGRQEGTEKSIYTPWPKFNDAA |
Ga0308011_101868381 | 3300031688 | Marine | MSKPQESWVGQHAAFSEALKYMNARQKGEEKSIYTPWPKFNDAAT |
Ga0308002_10651723 | 3300031703 | Marine | MTDKKAWGGQYTAFNEALKYMLDRQSGKEKSIQTPWPKFNDA |
Ga0315320_104957231 | 3300031851 | Seawater | MKKTSEAWVGQYAAFNEALKYMFKRSTGEEKSIYTPWPKFNDAATDGIEWNTL |
Ga0315315_101983981 | 3300032073 | Seawater | MKEQWESQHSDFNEALKYMKRRQQGLEKSIFTPWPK |
Ga0316207_100302581 | 3300032212 | Microbial Mat | MKKKESWVGQYAAFNEALKYMYARSTGEEKSIYTPWPKFNDAATDGIE |
Ga0316204_106515181 | 3300032373 | Microbial Mat | MAKPTEGWVGQYAAFNEALKYMQGRQNGTEKSIYTPWPKF |
Ga0314858_009827_3_134 | 3300033742 | Sea-Ice Brine | MSKPTESWTGQYAAFNEALKYMYARQKGEEKSIYTPWPKFNDAA |
Ga0314858_199820_387_512 | 3300033742 | Sea-Ice Brine | MKNKPSWIGQYAAFNDALKYMYARSTGDEKSIYTPWPKFNDA |
Ga0335035_0694174_413_523 | 3300034105 | Freshwater | MSKLQQEWAGQYTAFNDAIKYMINRASGEEKSIYTPW |
⦗Top⦘ |