NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090410

Metagenome / Metatranscriptome Family F090410

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090410
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 43 residues
Representative Sequence MSKPTESWTGQYAAFNEALKYMYARQKGEEKSIYTPWPKFNDAA
Number of Associated Samples 97
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 25.00 %
% of genes near scaffold ends (potentially truncated) 95.37 %
% of genes from short scaffolds (< 2000 bps) 87.96 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.963 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(23.148 % of family members)
Environment Ontology (ENVO) Unclassified
(61.111 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(67.593 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.72%    β-sheet: 0.00%    Coil/Unstructured: 65.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF08299Bac_DnaA_C 15.74
PF03167UDG 10.19
PF00149Metallophos 0.93
PF00871Acetate_kinase 0.93
PF01832Glucosaminidase 0.93
PF03819MazG 0.93
PF00271Helicase_C 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 15.74
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 10.19
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 10.19
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 10.19
COG0282Acetate kinaseEnergy production and conversion [C] 0.93
COG3426Butyrate kinaseEnergy production and conversion [C] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.37 %
UnclassifiedrootN/A4.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000973|BBAY93_10127255All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium644Open in IMG/M
3300001213|JGIcombinedJ13530_108329954All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium968Open in IMG/M
3300001344|JGI20152J14361_10062051All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium903Open in IMG/M
3300001934|GOS2267_101705All Organisms → cellular organisms → Bacteria1760Open in IMG/M
3300002488|JGI25128J35275_1088496All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium631Open in IMG/M
3300003270|JGI26113J46593_1028111All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium613Open in IMG/M
3300004113|Ga0065183_10791319All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium505Open in IMG/M
3300006425|Ga0075486_1826406All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium794Open in IMG/M
3300006734|Ga0098073_1023350All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium910Open in IMG/M
3300006737|Ga0098037_1213481All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium628Open in IMG/M
3300006750|Ga0098058_1199877All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium520Open in IMG/M
3300006752|Ga0098048_1133010All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium745Open in IMG/M
3300006790|Ga0098074_1017114All Organisms → Viruses → Predicted Viral2236Open in IMG/M
3300006924|Ga0098051_1147127All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium623Open in IMG/M
3300006929|Ga0098036_1041036All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1444Open in IMG/M
3300006947|Ga0075444_10304083All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium615Open in IMG/M
3300007540|Ga0099847_1103082All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium868Open in IMG/M
3300007559|Ga0102828_1164598All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium560Open in IMG/M
3300007667|Ga0102910_1017240All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1620Open in IMG/M
3300008470|Ga0115371_10289923All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1338Open in IMG/M
3300009135|Ga0118736_10183777All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium638Open in IMG/M
3300009172|Ga0114995_10838495All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium504Open in IMG/M
3300009425|Ga0114997_10574318All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium596Open in IMG/M
3300009428|Ga0114915_1183173All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium582Open in IMG/M
3300009432|Ga0115005_10665697Not Available835Open in IMG/M
3300009512|Ga0115003_10613753All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium634Open in IMG/M
3300009593|Ga0115011_10578767All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium902Open in IMG/M
3300009593|Ga0115011_11001789All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium707Open in IMG/M
3300009786|Ga0114999_10780885All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium707Open in IMG/M
3300010149|Ga0098049_1263468All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium523Open in IMG/M
3300010153|Ga0098059_1158774All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium889Open in IMG/M
3300010153|Ga0098059_1329576All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium581Open in IMG/M
3300010392|Ga0118731_114935307All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1401Open in IMG/M
3300011013|Ga0114934_10542924All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium513Open in IMG/M
3300011268|Ga0151620_1164362All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium679Open in IMG/M
3300012954|Ga0163111_10162000All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1903Open in IMG/M
3300013101|Ga0164313_10571893All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium937Open in IMG/M
3300017713|Ga0181391_1096790All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium668Open in IMG/M
3300017742|Ga0181399_1036223All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1322Open in IMG/M
3300017744|Ga0181397_1112865All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium709Open in IMG/M
3300017744|Ga0181397_1115299All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium700Open in IMG/M
3300017762|Ga0181422_1141411All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium740Open in IMG/M
3300017763|Ga0181410_1130679All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium713Open in IMG/M
3300017768|Ga0187220_1179442All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium639Open in IMG/M
3300017769|Ga0187221_1077160All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1038Open in IMG/M
3300017772|Ga0181430_1151413All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium674Open in IMG/M
3300017782|Ga0181380_1232270All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium614Open in IMG/M
3300017782|Ga0181380_1254359All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium582Open in IMG/M
3300017952|Ga0181583_10735769All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium584Open in IMG/M
3300017956|Ga0181580_10126117All Organisms → Viruses → Predicted Viral1853Open in IMG/M
3300017967|Ga0181590_10144523All Organisms → Viruses → Predicted Viral1825Open in IMG/M
3300020175|Ga0206124_10382512All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium526Open in IMG/M
3300020182|Ga0206129_10000164All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales114890Open in IMG/M
3300020410|Ga0211699_10273616All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium655Open in IMG/M
3300020430|Ga0211622_10254350All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium752Open in IMG/M
3300020438|Ga0211576_10611414All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium541Open in IMG/M
3300020452|Ga0211545_10119982All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1231Open in IMG/M
3300021368|Ga0213860_10404561All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium590Open in IMG/M
3300022057|Ga0212025_1029076All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium926Open in IMG/M
3300022187|Ga0196899_1162211All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium614Open in IMG/M
3300022308|Ga0224504_10457219All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium532Open in IMG/M
(restricted) 3300023112|Ga0233411_10005892All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium3469Open in IMG/M
(restricted) 3300023112|Ga0233411_10062717All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1166Open in IMG/M
3300023116|Ga0255751_10080439All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium2096Open in IMG/M
3300023170|Ga0255761_10576746All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium514Open in IMG/M
3300023172|Ga0255766_10141289All Organisms → Viruses → Predicted Viral1387Open in IMG/M
3300024229|Ga0233402_1024198All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1325Open in IMG/M
3300024328|Ga0228635_1048271All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1151Open in IMG/M
(restricted) 3300024528|Ga0255045_10206741All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium767Open in IMG/M
3300024555|Ga0255280_1043096All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium931Open in IMG/M
3300025057|Ga0208018_116739All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium908Open in IMG/M
3300025097|Ga0208010_1112906All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium550Open in IMG/M
3300025110|Ga0208158_1077069All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium797Open in IMG/M
3300025647|Ga0208160_1078958All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium885Open in IMG/M
3300025873|Ga0209757_10210935All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium615Open in IMG/M
3300026203|Ga0207985_1129348All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium583Open in IMG/M
3300027631|Ga0208133_1005031All Organisms → cellular organisms → Bacteria3956Open in IMG/M
3300027631|Ga0208133_1165363All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium509Open in IMG/M
3300027736|Ga0209190_1170035All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium925Open in IMG/M
3300027742|Ga0209121_10182147All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium771Open in IMG/M
3300027780|Ga0209502_10429906All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium533Open in IMG/M
3300027791|Ga0209830_10247267All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium811Open in IMG/M
3300027791|Ga0209830_10418823All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium566Open in IMG/M
3300027858|Ga0209013_10227817All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1107Open in IMG/M
(restricted) 3300027861|Ga0233415_10027566All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium2289Open in IMG/M
3300027978|Ga0209165_10164486All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium768Open in IMG/M
(restricted) 3300027996|Ga0233413_10024250All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium2268Open in IMG/M
(restricted) 3300027996|Ga0233413_10041825All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1754Open in IMG/M
3300028136|Ga0228608_1039553All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1381Open in IMG/M
3300031167|Ga0308023_1063668All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium698Open in IMG/M
3300031566|Ga0307378_10157886All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium2278Open in IMG/M
3300031566|Ga0307378_10347073All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1383Open in IMG/M
3300031566|Ga0307378_10859767All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon756Open in IMG/M
3300031578|Ga0307376_10211530All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1320Open in IMG/M
3300031602|Ga0307993_1104999All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium711Open in IMG/M
3300031659|Ga0307986_10147555All Organisms → Viruses → Predicted Viral1095Open in IMG/M
3300031688|Ga0308011_10186838All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium625Open in IMG/M
3300031703|Ga0308002_1065172All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium808Open in IMG/M
3300031851|Ga0315320_10495723All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium825Open in IMG/M
3300032212|Ga0316207_10030258All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium3192Open in IMG/M
3300032373|Ga0316204_10651518All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium768Open in IMG/M
3300033742|Ga0314858_009827All Organisms → Viruses → Predicted Viral1901Open in IMG/M
3300033742|Ga0314858_199820All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium513Open in IMG/M
3300034105|Ga0335035_0694174All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18523Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine23.15%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater11.11%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.48%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh6.48%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.56%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.63%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.63%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.70%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil3.70%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.85%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine1.85%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.85%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.85%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.85%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.85%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.85%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.93%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.93%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.93%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.93%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.93%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.93%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.93%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.93%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.93%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.93%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.93%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment0.93%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001344Pelagic Microbial community sample from North Sea - COGITO 998_met_02EnvironmentalOpen in IMG/M
3300001934Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300003270Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_17_M020EnvironmentalOpen in IMG/M
3300004113Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2)EnvironmentalOpen in IMG/M
3300006425Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300009135Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsfEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020430Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020452Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078)EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300023170Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaGEnvironmentalOpen in IMG/M
3300023172Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaGEnvironmentalOpen in IMG/M
3300024229Seawater microbial communities from Monterey Bay, California, United States - 54DEnvironmentalOpen in IMG/M
3300024328Seawater microbial communities from Monterey Bay, California, United States - 44DEnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300024555Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025057Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025097Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300026203Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027742Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027858Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027978Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028136Seawater microbial communities from Monterey Bay, California, United States - 9DEnvironmentalOpen in IMG/M
3300031167Marine microbial communities from water near the shore, Antarctic Ocean - #418EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031659Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82EnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031703Marine microbial communities from water near the shore, Antarctic Ocean - #34EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032212Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-week pyriteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BBAY93_1012725513300000973Macroalgal SurfaceMTKIKPAWDGQYQSFNEALKYMLARQSGKEKSIQTPWPKFNDAITDGLEWN
JGIcombinedJ13530_10832995433300001213WetlandMSKPEKAWNGQYASFNEALKYMQKRAAGQEKSIYTP
JGI20152J14361_1006205113300001344Pelagic MarineMAKPTEGWVGQYAAFNEALKYMQGRQNGTEKSIYTPWPKFN
GOS2267_10170533300001934MarineMSRPKPAWVGQYEAFNDALKYMYARSKGDEKSIFTPWPKFN
JGI25128J35275_108849623300002488MarineMSKKAWDGQYQSFNEALRYMLDRQSGKEKSIYTPWSKFNDAVTDGL
JGI26113J46593_102811123300003270MarineMGKPTPAWVGQYTAFNDALKYMYARSTGEEKSIYTPWPKFNDAATDGLEWNT
Ga0065183_1079131923300004113Pelagic MarineMGKTDKSWVGQHAAFSEALKYMNARQKGEEKSIYTPWPKFNDAATDGLE
Ga0075486_182640633300006425AqueousMSKFQKAWAGQYNAFNEALKYMQKRQTGEEKSIYTPW
Ga0098073_102335033300006734MarineMSKPEEAWVGQYAAFNDALKYMYKRANGEEKSIYTPW
Ga0098037_121348133300006737MarineMSKKSEPSWEGQYAAFNEALKYMYKRQTGEEKSIYTPWPKFNDATTDG
Ga0098058_119987723300006750MarineMKEEWQSQHIDFNEALKYMKRRQQGIEKSIYTPWPKFND
Ga0098048_113301013300006752MarineMSKVKPAWDGQYQSFNEALKYMLARQSGKEKSIQTPWPK
Ga0098074_101711463300006790MarineMKEAWHGQYQSFNEALKYMLDRQSGKEKSIQTPWPKFNDAVTDG
Ga0098051_114712713300006924MarineMSKAWHGQHTAFQEALRYMLDRQSGKEKSIYTPWHKFNDAVTDGL
Ga0098036_104103643300006929MarineMSKIKPAWDGQYQAFNEALKYMLARQNGTEKSIQTPWPKFNDAVTDGLEWNT
Ga0075444_1030408323300006947MarineMTDKKAWGGQYTAFNEALKYMLDRQSGKEKSIQTPWPKFNDAITDGLEWNTLT
Ga0070753_136154733300007346AqueousMQIKHEWQSQHVDYNEALKYMKRRQEGTEKSIYTPWPKFNDAA
Ga0099847_110308233300007540AqueousMSKTKESWAGQHTAFNEALKYMFRRSTGEEKSIYTPWPKFND
Ga0102828_116459833300007559EstuarineMSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYTP
Ga0102910_101724013300007667EstuarineMKKTSEAWVGQYAAFNEALKYMYRRSTGEEKSIYTPWPKFNDA
Ga0115371_1028992313300008470SedimentMSKTNKSWVGQHAAFSEALKYMNARQKGEEKSIYTPWPKFN
Ga0118736_1018377713300009135Marine SedimentMKKTSEAWVGQYAAFNEALKYMYARSTGEEKSIYTPWPK
Ga0114995_1083849513300009172MarineMKKTSEAWVGQYAAFNEALKYMFKRSTGEEKSIYTPWPKFNDAATDGL
Ga0114997_1057431813300009425MarineMSNKEWGGQYGSFNEALKYMLDRQSGKEKSIQTPWPKFNDAITDGLEWNT
Ga0114915_118317323300009428Deep OceanMSKPTPAWVGQYTAFNDALKYMYARSTGDEKSIYTPWPKFNDAATDGLEWN
Ga0115005_1066569753300009432MarineMSKPTPAWVGQYTAFNDALKYMYARSTGAEKSIYTPWPKFN
Ga0115003_1061375323300009512MarineMSKPTEGWVGQYAAFNEALKYMQGRQNGTEKSIYTPWPKFNDAATDGLEWNTL
Ga0115011_1057876733300009593MarineMSKVKPAWDGQYQSFNEALKYMLARQSGKEKSIQTPWPKFNDAVTDGLEW
Ga0115011_1100178913300009593MarineMKAEKAWVGKHGSFNEALKYMQRRQQGIEKSIYTPWPKFNDAATDGLEWNT
Ga0114999_1078088523300009786MarineMKKTSEAWVGQYAAFNEALKYMFKRSTGEEKSIYTPWP
Ga0098049_126346833300010149MarineMSKVKEEWIGQFSAFNEALKYMSKRANGEEKSIYTPWAKFNDATTDGL
Ga0098059_115877433300010153MarineMSTVKPAWDGQYQAFNDALKYMLARQSGKEKSIQTPWPKFNDAITDG
Ga0098059_132957613300010153MarineMSKVKPAWDGQYQAFNEALKYMLARQSGQEKSIQTPWPKF
Ga0118731_11493530743300010392MarineMGKTDKSWVGQHAAFSEALKYMNARQKGEEKSIYTPWPKFNDAA
Ga0114934_1054292423300011013Deep SubsurfaceMSKAWNGQYQSFNEALKYMLDRQSGKEKSIQTPWPKFNDAVTD
Ga0151620_116436223300011268FreshwaterMSKPEKAWNGQYASFNEALKYMQKRAAGQEKSIYTPWPKFNDATTDGLEWNTLTV
Ga0163111_1016200013300012954Surface SeawaterMKKKPSWVGQYAAFNEALKYMYARSTGEEKSIYTPWP
Ga0164313_1057189333300013101Marine SedimentMSKPKPAWVGQYQAFNDALKYMYARSTGEEKSIYTP
Ga0181391_109679033300017713SeawaterMSKAQKAWAGQYQAFNEALKYMNNRMHGEERSILTPWSKFND
Ga0181399_103622313300017742SeawaterMSKAQKAWAGQYQAFNEALKYMNNRMHGEERSILTPWSKFNDAGTDGIE
Ga0181397_111286523300017744SeawaterMKKTSEAWVGQYAAFNEALKYMFKRSTGEEKSIYTPWPKFNDAATDGIEWNT
Ga0181397_111529913300017744SeawaterMKNKPSWIGQYAAFNEALKYMYARSTGEEKSIYTPWPKF
Ga0181422_114141123300017762SeawaterMGKPTPAWVGQYTAFNDALKYMYARSTGEEKSIYTPWPKFN
Ga0181410_113067923300017763SeawaterMSDNAWGGQYTAFNEALKYMLDRQSGKEKSIQTPWPKFND
Ga0187220_117944223300017768SeawaterMSNKAWNGQYQSFNEALKYMLDRQSGKEKSIYTPWPKFNDAVTDGL
Ga0187221_107716013300017769SeawaterMSKAQKAWAGQYQAFNEALKYMNNRMHGEERSILTPC
Ga0181430_115141323300017772SeawaterMSNDKLWNGQYTAFNEALKYMLDRQSGKEKSIQTP
Ga0181380_123227023300017782SeawaterMKKTSEAWVGQYAAFNEALKYMYRRSTGEEKSIYTPWP
Ga0181380_125435913300017782SeawaterMSKVDKAWDGQYTAFNEALKYMHNRQQGKEKSVLTPWPKFNDAATD
Ga0181583_1073576933300017952Salt MarshMSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWP
Ga0181580_1012611713300017956Salt MarshMSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWPKFNDATTDGLEWNTLTV
Ga0181590_1014452353300017967Salt MarshMSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWPKFNDATTDGL
Ga0181585_1051537613300017969Salt MarshMQVKKEWQSQNIDFNDALNYMKRRQEGTEKSIYTPWPKFNDAGTDG
Ga0206124_1038251213300020175SeawaterMSKPTPAWVGQYTAFNDALKYMYARSTGDEKSIYTP
Ga0206129_1000016413300020182SeawaterMSKPTPAWVGQYTAFNDALKYMYARSTGDEKSIYTPWPKFND
Ga0211699_1027361613300020410MarineMSKIKPAWDGQYQAFNEALKYMLARQSGKEKSIQT
Ga0211622_1025435023300020430MarineMSKKPAWNGQYESFNEALKYMFQRQSGEEKSIYTPWPKFNDATTDGLEWNTLTV
Ga0211576_1061141413300020438MarineMSDNAWGGQYTAFNEALKYMLDRQSGKEKSIQTPWPKFNDAITDGLEWNTLTV
Ga0211545_1011998233300020452MarineMKKKESWVGQYAAFNEALKYMYARSTGEEKSIYTPWPK
Ga0213860_1040456123300021368SeawaterMSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWPKFNDATTDG
Ga0212025_102907613300022057AqueousMSNIEQAWNGQHTAFQDALKYMLNRQTGKEKSIYTPWPKFNDATTDGLEWNS
Ga0212026_103986233300022069AqueousMQRKHEWQSQHVDYNEALKYMKRRQEGTEKSIYTPWPK
Ga0196899_116221113300022187AqueousMSKPTPGWGGQFSAFKEALKYMSARQSGEEKSIYTPWPKFN
Ga0224504_1045721923300022308SedimentMSKAQEEWAGQYTAFNEALKYMTKRANGEEKSIYTPWAKFNDATTDGLEWNT
(restricted) Ga0233411_1000589213300023112SeawaterMSRPTEGWVGQYAAFNEALKYMQGRQNGTEKSIYTPWPKFNDAATDGL
(restricted) Ga0233411_1006271713300023112SeawaterMSKTKKHWEGQYDSFNVALKYMLDRQTGIEKSIFTPWHKFNDAG
Ga0255751_1008043913300023116Salt MarshMSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWPKFNDATTDGLEW
Ga0255761_1057674613300023170Salt MarshMSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWPKFND
Ga0255766_1014128913300023172Salt MarshMSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYT
Ga0233402_102419843300024229SeawaterMSKTKESWSGQHTAFNEALKYMFRRSTGEEKSIYTPWPKFNDATTDGLEWNTLTV
Ga0228635_104827113300024328SeawaterMGKPTPAWVGQYTAFNDALKYMYARSTGEEKSIYTPWPKFNDAATDG
(restricted) Ga0255045_1020674123300024528SeawaterMKKTSEAWVGQYAAFNEALKYMYRRSTGEEKSIYTPWPKFNDAA
Ga0255280_104309613300024555FreshwaterMSKPEKAWNGQYASFNEALKYMQKRAAGQEKSIYTPWPKFND
Ga0208018_11673933300025057MarineMSKPEEAWVGQYAAFNDALKYMYKRANGEEKSIYTP
Ga0208010_111290613300025097MarineMNKLKPQWGGQYQNFNDALKYMLDRQNGDEKSIFTPWPKFNDAGTDGLEWNTLT
Ga0208158_107706923300025110MarineMSKIKPAWDGQYQSFNEALKYMLARQSGKEKSIQTPWPKFNDAITDGLEWN
Ga0208160_107895813300025647AqueousMSKPTESWIGQYAAFNDALKYMHARSVGEEKSIYTPWPKFNDAT
Ga0209757_1021093513300025873MarineMSKVKPAWDGQYQAFNEALKYMLARQSGKEKSIQTPWPKFND
Ga0207985_112934823300026203MarineMSKTNDAWIGQYAAFNEALKYMYKRSTGEEKSIYTPWPKFNDATTDG
Ga0208133_1005031113300027631EstuarineMSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYT
Ga0208133_116536313300027631EstuarineMSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYTPWPKFNDATTDGLEW
Ga0209190_117003513300027736Freshwater LakeMSKPTESWIGQYAAFNDALKYMYKRQTGEEKSIYTPWPK
Ga0209121_1018214713300027742MarineMKKTSEAWVGQYAAFNEALKYMYRRSTGEEKSIYTPWPKFN
Ga0209502_1042990613300027780MarineMSKSTGAWIGQFAAFNEALKYMYARQKGEEKSIYTPWPKFNDAA
Ga0209830_1024726713300027791MarineMSNEKPWNGQYTAFNEALKYMLDRQSGKEKSIQTPWLK
Ga0209830_1041882333300027791MarineMGKTDKSWVGQHAAFSEALKYMSARSKGEEKSIYTPWPKFNDAATDGLEWN
Ga0209013_1022781733300027858MarineMKKKESWIGQYAAFNEALKYMHARSTGDEKSIYTPWPKFNDAATD
(restricted) Ga0233415_1002756653300027861SeawaterMSNKSGSWVGQYAAFNEALKYMYARQKGEEKSIYTPW
Ga0209165_1016448613300027978Marine SedimentMSKTKESWVGQYTAFNEALKYMFRRSTGEEKSIYTPWPKFN
(restricted) Ga0233413_1002425013300027996SeawaterMSKPTPAWVGQYTAFNDALKYMYARSTGDEKSIYTPWPKFNDAATDGLE
(restricted) Ga0233413_1004182553300027996SeawaterMWNGQHTAFQEALRYMLDRQSGKEKSIYTPWPKFNDAITDGLEWN
Ga0228608_103955343300028136SeawaterMSKTKESWSGQHTAFNEALKYMFRRSTGEEKSIYTPWPKFN
Ga0308023_106366813300031167MarineMGKTENAWVGQYSNFNEALKYMLARSNGEEKSIYTPWPKFNDAATD
Ga0307378_1015788613300031566SoilMSKATEAWIGQYAAFNEALKYMRGRQNGTEKSIYTPW
Ga0307378_1034707313300031566SoilMSRQKPAWGGQNESFNEALKYMLNRQKGLEKSIYT
Ga0307378_1085976733300031566SoilMSRPKPAWVGQYEAFNDALKYMYARSTGDEKSIYTPWPKFNDACTDGLE
Ga0307376_1021153053300031578SoilMSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYTPWPK
Ga0307993_110499913300031602MarineMSKPQESWVGQHAAFSEALKYMNARQKGEEKSIYTPWPKFNDAATD
Ga0307986_1014755543300031659MarineMSRPTEEWVGQYAAFNEALKYMKGRQEGTEKSIYTPWPKFNDAA
Ga0308011_1018683813300031688MarineMSKPQESWVGQHAAFSEALKYMNARQKGEEKSIYTPWPKFNDAAT
Ga0308002_106517233300031703MarineMTDKKAWGGQYTAFNEALKYMLDRQSGKEKSIQTPWPKFNDA
Ga0315320_1049572313300031851SeawaterMKKTSEAWVGQYAAFNEALKYMFKRSTGEEKSIYTPWPKFNDAATDGIEWNTL
Ga0315315_1019839813300032073SeawaterMKEQWESQHSDFNEALKYMKRRQQGLEKSIFTPWPK
Ga0316207_1003025813300032212Microbial MatMKKKESWVGQYAAFNEALKYMYARSTGEEKSIYTPWPKFNDAATDGIE
Ga0316204_1065151813300032373Microbial MatMAKPTEGWVGQYAAFNEALKYMQGRQNGTEKSIYTPWPKF
Ga0314858_009827_3_1343300033742Sea-Ice BrineMSKPTESWTGQYAAFNEALKYMYARQKGEEKSIYTPWPKFNDAA
Ga0314858_199820_387_5123300033742Sea-Ice BrineMKNKPSWIGQYAAFNDALKYMYARSTGDEKSIYTPWPKFNDA
Ga0335035_0694174_413_5233300034105FreshwaterMSKLQQEWAGQYTAFNDAIKYMINRASGEEKSIYTPW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.