Scaffold Ga0196970_1000447

Overview

Basic Information

• Taxon OID: 3300020156
• Scaffold ID: Ga0196970_1000447
• Source Dataset Name: Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_5-13C
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 48044
• Total Scaffold Genes: 44
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (31.82%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.3049
  • Long. (^o): -116.2547
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069970	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0196970_100044736	F069970	N/A	MNTGKYSQAIKIGDRVTFDNDRVADFKAETSMDNKEIQQYQKLVLAGIDQVGVVKGFMGNLTNVSYPDGWELPVPAKYLVVLPKSDE