| Basic Information | |
|---|---|
| Taxon OID | 3300019826 Open in IMG/M |
| Scaffold ID | Ga0197828_1005897 Open in IMG/M |
| Source Dataset Name | Microbial mat bacterial communities from Rhone River delta, Camargue, France - 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Barcelona |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 538 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Microbial Mat → Microbial Mat Bacterial Communities From Rhone River Delta, Camargue, France |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rhone delta, Camargue, France, EU | |||||||
| Coordinates | Lat. (o) | 43.6 | Long. (o) | 4.6 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033261 | Metagenome / Metatranscriptome | 178 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0197828_10058971 | F033261 | N/A | GKHEPLPGHSATRLCAETRRDEQGQLVREVEEDDTAFFLSAWLRCLVFNLMTRFAQAMGGKYTKMWAGTLLRKFIRRPATLYLIDKELHVVFDPFPDQDELQPLLDELNAKRTALPWLNNLVVQFRIADEEPLHPLTEPEKRNRLFGDG |
| ⦗Top⦘ |