3300019826: Microbial mat bacterial communities from Rhone River delta, Camargue, France - 2

Overview

Basic Information

• IMG/M Taxon OID: 3300019826
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0129318 | Gp0220892 | Ga0197828
• Sample Name: Microbial mat bacterial communities from Rhone River delta, Camargue, France - 2
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Barcelona
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 62785259
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Mat Bacterial Communities From Rhone River Delta, Camargue, France
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Microbial Mat → Microbial Mat Bacterial Communities From Rhone River Delta, Camargue, France

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater river biome → delta → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Surface (saline)

Location Information

• Location: Rhone delta, Camargue, France, EU
• Coordinates
  • Lat. (^o): 43.6
  • Long. (^o): 4.6
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033261	Metagenome / Metatranscriptome	178	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0197828_1005897	Not Available	538
Ga0197828_1008104	All Organisms → cellular organisms → Bacteria	524

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0197828_1005897	Ga0197828_10058971	F033261	GKHEPLPGHSATRLCAETRRDEQGQLVREVEEDDTAFFLSAWLRCLVFNLMTRFAQAMGGKYTKMWAGTLLRKFIRRPATLYLIDKELHVVFDPFPDQDELQPLLDELNAKRTALPWLNNLVVQFRIADEEPLHPLTEPEKRNRLFGDG
Ga0197828_1008104	Ga0197828_10081041	F033261	PLPGHSATRLCAETRRDEQGQLVREVEEDDTAFFLSAWLRCLVFNLMTRFAQAMGGKYTKMWAGTLLRKFIRRPATLYLIDKELHVVFDPFPDQDELQPLLDELNAKRTALPWLNNLVVQFRIADEEPLHPLTEPEKRNRLFGDG