NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182031_1413426

Scaffold Ga0182031_1413426


Overview

Basic Information
Taxon OID3300019787 Open in IMG/M
Scaffold IDGa0182031_1413426 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4530
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022967Metagenome / Metatranscriptome212Y
F077700Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0182031_14134263F077700AGGMPFVDGNYHLHAITGVCTPACLLAASISVEAVTPPLVDRPFKELLLFW
Ga0182031_14134265F022967AGGAGVEAAGVEPASENVTGQETTCLFQFMPWALPQDVRDPRSERTRNACR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.