Basic Information | |
---|---|
Family ID | F077700 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 40 residues |
Representative Sequence | AIIILHAITGVCTPACLLAASISVEAVTPPLVGLAILKELLPD |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.71 % |
% of genes near scaffold ends (potentially truncated) | 86.32 % |
% of genes from short scaffolds (< 2000 bps) | 58.12 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.761 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil (12.821 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.513 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.991 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 29.58% β-sheet: 0.00% Coil/Unstructured: 70.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF13302 | Acetyltransf_3 | 11.11 |
PF10079 | BshC | 8.55 |
PF09862 | DUF2089 | 7.69 |
PF08240 | ADH_N | 3.42 |
PF00072 | Response_reg | 2.56 |
PF00188 | CAP | 2.56 |
PF12867 | DinB_2 | 2.56 |
PF13419 | HAD_2 | 2.56 |
PF00486 | Trans_reg_C | 1.71 |
PF00510 | COX3 | 1.71 |
PF05096 | Glu_cyclase_2 | 1.71 |
PF01145 | Band_7 | 1.71 |
PF02517 | Rce1-like | 0.85 |
PF00561 | Abhydrolase_1 | 0.85 |
PF12836 | HHH_3 | 0.85 |
PF01799 | Fer2_2 | 0.85 |
PF13469 | Sulfotransfer_3 | 0.85 |
PF16901 | DAO_C | 0.85 |
PF02518 | HATPase_c | 0.85 |
PF01810 | LysE | 0.85 |
PF13442 | Cytochrome_CBB3 | 0.85 |
PF13231 | PMT_2 | 0.85 |
PF01797 | Y1_Tnp | 0.85 |
PF03009 | GDPD | 0.85 |
PF00924 | MS_channel | 0.85 |
PF00702 | Hydrolase | 0.85 |
PF13950 | Obsolete Pfam Family | 0.85 |
PF01850 | PIN | 0.85 |
PF00872 | Transposase_mut | 0.85 |
PF09907 | HigB_toxin | 0.85 |
PF01402 | RHH_1 | 0.85 |
PF09084 | NMT1 | 0.85 |
PF02771 | Acyl-CoA_dh_N | 0.85 |
PF02472 | ExbD | 0.85 |
PF05598 | DUF772 | 0.85 |
PF04055 | Radical_SAM | 0.85 |
PF08281 | Sigma70_r4_2 | 0.85 |
PF00293 | NUDIX | 0.85 |
PF01555 | N6_N4_Mtase | 0.85 |
PF00756 | Esterase | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 2.56 |
COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.71 |
COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 1.71 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.85 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.85 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.85 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.85 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.85 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.85 |
COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.85 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.85 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.85 |
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.85 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.85 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.76 % |
Unclassified | root | N/A | 16.24 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10016675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4665 | Open in IMG/M |
3300001131|JGI12631J13338_1002204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4432 | Open in IMG/M |
3300001170|JGI12704J13340_1005604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1192 | Open in IMG/M |
3300001305|C688J14111_10020926 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
3300001356|JGI12269J14319_10000264 | All Organisms → cellular organisms → Bacteria | 49748 | Open in IMG/M |
3300001401|JGI20189J14885_1000854 | All Organisms → cellular organisms → Bacteria | 9678 | Open in IMG/M |
3300001593|JGI12635J15846_10000706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 29109 | Open in IMG/M |
3300001593|JGI12635J15846_10026471 | All Organisms → cellular organisms → Bacteria | 4685 | Open in IMG/M |
3300001661|JGI12053J15887_10020677 | All Organisms → cellular organisms → Bacteria | 3684 | Open in IMG/M |
3300005162|Ga0066814_10100200 | Not Available | 542 | Open in IMG/M |
3300005171|Ga0066677_10054456 | All Organisms → cellular organisms → Bacteria | 2010 | Open in IMG/M |
3300005329|Ga0070683_100262022 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
3300005336|Ga0070680_100308395 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300005435|Ga0070714_100936923 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300005445|Ga0070708_100395947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1302 | Open in IMG/M |
3300005445|Ga0070708_100741912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
3300005531|Ga0070738_10010945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8068 | Open in IMG/M |
3300005534|Ga0070735_10007438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8738 | Open in IMG/M |
3300005539|Ga0068853_100878573 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300005541|Ga0070733_10058662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 2416 | Open in IMG/M |
3300005541|Ga0070733_10113230 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
3300005541|Ga0070733_10596336 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300005542|Ga0070732_10351872 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300005559|Ga0066700_10853856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300005591|Ga0070761_10040754 | All Organisms → cellular organisms → Bacteria | 2605 | Open in IMG/M |
3300005591|Ga0070761_10292246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
3300005602|Ga0070762_10007900 | All Organisms → cellular organisms → Bacteria | 5245 | Open in IMG/M |
3300005602|Ga0070762_10013800 | All Organisms → cellular organisms → Bacteria | 4109 | Open in IMG/M |
3300005602|Ga0070762_10019171 | All Organisms → cellular organisms → Bacteria | 3549 | Open in IMG/M |
3300005610|Ga0070763_10064772 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
3300005712|Ga0070764_10480447 | Not Available | 744 | Open in IMG/M |
3300005712|Ga0070764_10628705 | Not Available | 656 | Open in IMG/M |
3300005921|Ga0070766_10001314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12054 | Open in IMG/M |
3300005921|Ga0070766_10299257 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300005921|Ga0070766_10497525 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300005994|Ga0066789_10306225 | Not Available | 665 | Open in IMG/M |
3300006052|Ga0075029_100049923 | All Organisms → cellular organisms → Bacteria | 2420 | Open in IMG/M |
3300006052|Ga0075029_100204966 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300006052|Ga0075029_100392538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 901 | Open in IMG/M |
3300006059|Ga0075017_100045015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 2948 | Open in IMG/M |
3300006059|Ga0075017_100643417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
3300006162|Ga0075030_100095914 | All Organisms → cellular organisms → Bacteria | 2422 | Open in IMG/M |
3300006173|Ga0070716_100028233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3021 | Open in IMG/M |
3300006174|Ga0075014_100559014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
3300006176|Ga0070765_100088557 | All Organisms → cellular organisms → Bacteria | 2646 | Open in IMG/M |
3300006800|Ga0066660_10235181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1422 | Open in IMG/M |
3300007788|Ga0099795_10424201 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300007982|Ga0102924_1243812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
3300009643|Ga0116110_1261635 | Not Available | 553 | Open in IMG/M |
3300009665|Ga0116135_1007786 | All Organisms → cellular organisms → Bacteria | 3965 | Open in IMG/M |
3300009665|Ga0116135_1201953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 760 | Open in IMG/M |
3300009824|Ga0116219_10001050 | All Organisms → cellular organisms → Bacteria | 26930 | Open in IMG/M |
3300009839|Ga0116223_10851236 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300009839|Ga0116223_10905182 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300010379|Ga0136449_100133842 | All Organisms → cellular organisms → Bacteria | 4928 | Open in IMG/M |
3300011120|Ga0150983_11916721 | Not Available | 534 | Open in IMG/M |
3300012189|Ga0137388_10241587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1641 | Open in IMG/M |
3300012200|Ga0137382_10731632 | Not Available | 710 | Open in IMG/M |
3300012203|Ga0137399_10490859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1029 | Open in IMG/M |
3300012207|Ga0137381_10028867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4460 | Open in IMG/M |
3300012685|Ga0137397_10701156 | Not Available | 752 | Open in IMG/M |
3300012917|Ga0137395_11135971 | Not Available | 551 | Open in IMG/M |
3300013306|Ga0163162_10042036 | All Organisms → cellular organisms → Bacteria | 4573 | Open in IMG/M |
3300014155|Ga0181524_10206102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 958 | Open in IMG/M |
3300014158|Ga0181521_10378841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 702 | Open in IMG/M |
3300014200|Ga0181526_10490658 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300014489|Ga0182018_10012935 | All Organisms → cellular organisms → Bacteria | 5840 | Open in IMG/M |
3300014495|Ga0182015_10479501 | Not Available | 796 | Open in IMG/M |
3300014502|Ga0182021_11572663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
3300015373|Ga0132257_100674736 | Not Available | 1282 | Open in IMG/M |
3300017946|Ga0187879_10007425 | All Organisms → cellular organisms → Bacteria | 7176 | Open in IMG/M |
3300017946|Ga0187879_10024054 | All Organisms → cellular organisms → Bacteria | 3739 | Open in IMG/M |
3300017975|Ga0187782_11102981 | Not Available | 619 | Open in IMG/M |
3300018026|Ga0187857_10074330 | Not Available | 1688 | Open in IMG/M |
3300018030|Ga0187869_10027917 | Not Available | 3140 | Open in IMG/M |
3300018034|Ga0187863_10046155 | All Organisms → cellular organisms → Bacteria | 2507 | Open in IMG/M |
3300018040|Ga0187862_10375241 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300018042|Ga0187871_10036499 | All Organisms → cellular organisms → Bacteria | 3041 | Open in IMG/M |
3300018047|Ga0187859_10031301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2878 | Open in IMG/M |
3300018088|Ga0187771_10014557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5764 | Open in IMG/M |
3300019362|Ga0173479_10756282 | Not Available | 532 | Open in IMG/M |
3300019787|Ga0182031_1413426 | All Organisms → cellular organisms → Bacteria | 4530 | Open in IMG/M |
3300020582|Ga0210395_10006762 | All Organisms → cellular organisms → Bacteria | 8690 | Open in IMG/M |
3300021171|Ga0210405_10185285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1650 | Open in IMG/M |
3300021401|Ga0210393_10080399 | All Organisms → cellular organisms → Bacteria | 2580 | Open in IMG/M |
3300021405|Ga0210387_10339222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1326 | Open in IMG/M |
3300021407|Ga0210383_10064038 | All Organisms → cellular organisms → Bacteria | 3070 | Open in IMG/M |
3300021413|Ga0193750_1043395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 971 | Open in IMG/M |
3300021433|Ga0210391_10000586 | All Organisms → cellular organisms → Bacteria | 37035 | Open in IMG/M |
3300022557|Ga0212123_10272112 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
3300025412|Ga0208194_1008767 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
3300025915|Ga0207693_10000273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 47746 | Open in IMG/M |
3300027562|Ga0209735_1009916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1828 | Open in IMG/M |
3300027648|Ga0209420_1000489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 20739 | Open in IMG/M |
3300027676|Ga0209333_1001742 | All Organisms → cellular organisms → Bacteria | 10150 | Open in IMG/M |
3300027692|Ga0209530_1074314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 978 | Open in IMG/M |
3300027701|Ga0209447_10131484 | Not Available | 687 | Open in IMG/M |
3300027855|Ga0209693_10067595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1761 | Open in IMG/M |
3300027867|Ga0209167_10145676 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
3300027884|Ga0209275_10029184 | All Organisms → cellular organisms → Bacteria | 2535 | Open in IMG/M |
3300027889|Ga0209380_10003973 | All Organisms → cellular organisms → Bacteria | 9104 | Open in IMG/M |
3300027908|Ga0209006_10132350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2197 | Open in IMG/M |
3300027908|Ga0209006_10171536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1895 | Open in IMG/M |
3300027911|Ga0209698_10018026 | All Organisms → cellular organisms → Bacteria | 6790 | Open in IMG/M |
3300027911|Ga0209698_10126041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2118 | Open in IMG/M |
3300028808|Ga0302228_10139356 | Not Available | 1122 | Open in IMG/M |
3300029982|Ga0302277_1143626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
3300030007|Ga0311338_10052484 | All Organisms → cellular organisms → Bacteria | 5416 | Open in IMG/M |
3300030507|Ga0302192_10071286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1696 | Open in IMG/M |
3300031234|Ga0302325_10510824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1811 | Open in IMG/M |
3300031234|Ga0302325_11026856 | Not Available | 1122 | Open in IMG/M |
3300031236|Ga0302324_100662990 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300031344|Ga0265316_10699631 | Not Available | 714 | Open in IMG/M |
3300031525|Ga0302326_10378443 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
3300031525|Ga0302326_10998033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
3300032180|Ga0307471_100222937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1911 | Open in IMG/M |
3300034681|Ga0370546_073089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 565 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 12.82% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.26% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.69% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.84% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.98% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.98% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.98% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.13% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.42% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.56% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.71% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.71% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.71% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.71% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.71% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.71% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.85% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
3300001170 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001401 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_100166757 | 3300000567 | Peatlands Soil | AISGVCTPACLLAASISVEAVTPPLVGLAFKELLPD* |
JGI12631J13338_10022041 | 3300001131 | Forest Soil | AIIILHAITGVCTPACLLAASISVEAVTPPLVGMAFKATSILRSK* |
JGI12704J13340_10056042 | 3300001170 | Forest Soil | LAIIILLTITGVCPPACLLAASISVEAVTPPLVGMACKELFPD* |
C688J14111_100209263 | 3300001305 | Soil | LAIIILHAITGVCTPACLLAASISVEAVTPPLVGIGL* |
JGI12269J14319_1000026410 | 3300001356 | Peatlands Soil | LAIIILHAISGVCTPACLLAASISVEAVTPPLVGLAFKELLPD* |
JGI20189J14885_10008542 | 3300001401 | Arctic Peat Soil | LAIIILPTITGASTLACLLAASISVEAVTPPLVGLAVKELLPD* |
JGI12635J15846_100007061 | 3300001593 | Forest Soil | IIILHAITGVCTPACLLAASISVEAVTPPLVGLAWKELLPD* |
JGI12635J15846_100264717 | 3300001593 | Forest Soil | ITGVCTPACLLAASISVEAVTPPLVGLAILKELNPD* |
JGI12053J15887_100206771 | 3300001661 | Forest Soil | IIIVPTITGVCTPACLLAASISVEAVTPPLVGWPYSKNYFQTRCETKGSQTTN* |
Ga0066814_101002001 | 3300005162 | Soil | LAIIILPTITGASTLACLLAASISVEAVTPPLVGMAFKEQDNRP* |
Ga0066677_100544564 | 3300005171 | Soil | LAIVVLHAITGVCTPACLLAASISVEAVTPPLVGWPFKEPLPI* |
Ga0070683_1002620221 | 3300005329 | Corn Rhizosphere | LPTITGASTLACLLAASISVEAVTPPLVGMAFKEQDNRP* |
Ga0070680_1003083953 | 3300005336 | Corn Rhizosphere | AIIILPTITGASTLACLLAASISVEAVTPPLVGMAFKEQDNRP* |
Ga0070714_1009369231 | 3300005435 | Agricultural Soil | LAIIILHAITGVCTPACLLAASISVEAVTPPYLGLACKDPLPI* |
Ga0070708_1003959472 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SVWLAIVVLHAITGVCTPACLLAASISVEAVTPPLVGLAF* |
Ga0070708_1007419121 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VLHAITGVCTPACLLAASISVEAVTPPLVGLAFKELLSFY* |
Ga0070738_100109456 | 3300005531 | Surface Soil | LAIIILLTIAGVCTPACLLAASISVEAVTPPLVGFGHSKELLPD* |
Ga0070735_100074381 | 3300005534 | Surface Soil | LAIIILHAITGVCTPACLLAASISVEAVTPPLVGLAMQ |
Ga0068853_1008785732 | 3300005539 | Corn Rhizosphere | LAIIILPTITGASTLACLLAASISVEAVTPPLVGMAFKEQDNRP |
Ga0070733_100586624 | 3300005541 | Surface Soil | LAIIILHAIAGVCTPACLLAASISVEAVTPPLVGLACKEPLPD* |
Ga0070733_101132304 | 3300005541 | Surface Soil | AIIILPTITGVCTPACLLAASISVEAVTPPLVGLAILKEPLPD* |
Ga0070733_105963362 | 3300005541 | Surface Soil | LAIIILHAIAGVCTLACLLAASISVEAVTPPLVGMACKELLPD* |
Ga0070732_103518721 | 3300005542 | Surface Soil | HAITGVCTPACLLAASISVEAVTPPLMGRALKELLPD* |
Ga0066700_108538561 | 3300005559 | Soil | ITGVCTPACLLAASISVEAVTPPLVGLACKDPLPI* |
Ga0070761_100407541 | 3300005591 | Soil | LAIIILPTITGVCTPACLLAASISVEAVTPPLVGLAILKELIPD* |
Ga0070761_102922464 | 3300005591 | Soil | TGVCTPACLLAASISVEAVTPPLVGLAILKEPLPD* |
Ga0070762_100079001 | 3300005602 | Soil | LAIIILPTITGVCTPACLLAASISVEAVTPPLVGLAILKELVPD* |
Ga0070762_100138004 | 3300005602 | Soil | LAIIILHAITGVCTLACLLAASISVEAVTPPLVGIGL* |
Ga0070762_100191711 | 3300005602 | Soil | LAIIILLTITGVCPPACLLAASISVEAVTPPLMRMACKELIPD* |
Ga0070763_100647721 | 3300005610 | Soil | AIIILHAITGVCTPACLLAASISVEAVTPPLVGLAILKELLPD* |
Ga0070764_104804471 | 3300005712 | Soil | IIILHAITGVCTPACLLAASISVEAVTPPLVGLACKEPLPD* |
Ga0070764_106287052 | 3300005712 | Soil | LAIIILPTITGASTLACLLAASISVEAVTPPLVGLAL* |
Ga0070766_100013141 | 3300005921 | Soil | AITGVCTPACLLAASISVEAVTPPLVGLAILKELLPD* |
Ga0070766_102992571 | 3300005921 | Soil | TGVCTPACLLAASISVEAVTPPLVGLAILKELVSD* |
Ga0070766_104975251 | 3300005921 | Soil | RMPFVDWQIILLTITGVCTPACLLAASISVEAVTPPLVGLAVLKELLPD* |
Ga0066789_103062252 | 3300005994 | Soil | LAIIIFHAITGVWTPACLLAASISVEAVTPPLMGMAFKEQTTWA* |
Ga0075029_1000499234 | 3300006052 | Watersheds | CHLLIGNIIFHAITGVWTPACLLAASISVEAVTPPLVGWPFKEQ* |
Ga0075029_1002049661 | 3300006052 | Watersheds | LIGNIILHAITGVCTPACLLAASISVEAVTPPLVGNGL* |
Ga0075029_1003925381 | 3300006052 | Watersheds | LAIIILHAIAGVCTPACLLAASISVESGTPPLVGLASKELPLF* |
Ga0075017_1000450156 | 3300006059 | Watersheds | CHLLIGNIIFHAITGVWTPACLLAASISVEAVTPPLVGWPCKEPLPI* |
Ga0075017_1006434172 | 3300006059 | Watersheds | ITGVCTPACLLAESISVEAVTPPLVGMADSKNKAL* |
Ga0075030_1000959142 | 3300006162 | Watersheds | LAIIIFHAITGVWTPACLLAASISVEAVTPPLVGWPFKEQ* |
Ga0070716_1000282333 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LAIIILHAITGVCTPACLLAESISVEAVTPPLVGWPCKEQE* |
Ga0075014_1005590141 | 3300006174 | Watersheds | LAIIILHAITGVCTPACLLAASISVEAVTPPLVG* |
Ga0070765_1000885571 | 3300006176 | Soil | AIIILPTITGVCTPACLLAASISVEAVTPPLVGLAILKELVPD* |
Ga0066660_102351811 | 3300006800 | Soil | AYASVWLAIVVLHAITGVCTPACLLAASISVEAVTPPLVGLAF* |
Ga0099795_104242012 | 3300007788 | Vadose Zone Soil | LHAITGVCTPACLLAASISVEAVTPPLVGLAVVKELLPD* |
Ga0102924_12438121 | 3300007982 | Iron-Sulfur Acid Spring | TITGVCTPACLLAASISVEAVTPPLVGLAILKELVPD* |
Ga0116110_12616351 | 3300009643 | Peatland | AITGVCTPACLLAASISVEAVTPPLVGLAILKELFPI* |
Ga0116135_10077861 | 3300009665 | Peatland | ITGVCTPACLLAASISVEAVTPPLVGMACKELLPD* |
Ga0116135_12019531 | 3300009665 | Peatland | IILLTITGVCTPACLLAASISVEAVTPPLVGLAILKELFPI* |
Ga0116219_100010501 | 3300009824 | Peatlands Soil | TGVCTPACLLAASISVEAVTPPLVGLAFKELLPD* |
Ga0116223_108512361 | 3300009839 | Peatlands Soil | ITGVCTPACLLAASISVEAVTPPLVGLALQKNYF* |
Ga0116223_109051822 | 3300009839 | Peatlands Soil | LHAITGVCTPACLLAASISVEAVTPPLVGLAVQKSYF* |
Ga0136449_1001338421 | 3300010379 | Peatlands Soil | ITGVCTPACLLAASISVEAVTPQLVGLAILKELLPD* |
Ga0150983_119167211 | 3300011120 | Forest Soil | IIILPTITGVCTPACLLAASISVEAVTPPLVGLAVLKELLPD* |
Ga0137388_102415875 | 3300012189 | Vadose Zone Soil | IILHAITGVCTPACLLAASISVEAVTPPLVGWAFKELPLFWG* |
Ga0137382_107316321 | 3300012200 | Vadose Zone Soil | PTITGVCTPACLLAASISVEAVTPPLVGLALKDLLPI* |
Ga0137399_104908592 | 3300012203 | Vadose Zone Soil | AAYASVWLAIVVLHAITGVCTPACLLAASISVEAVTPPLVGLAF* |
Ga0137381_100288671 | 3300012207 | Vadose Zone Soil | ASVWLAIVVLHAITGVCTPACLLAASISVEAVTPPLVGLAF* |
Ga0137397_107011562 | 3300012685 | Vadose Zone Soil | AIIILPTITGVCTPACLLAASISVEAVTPPLVGMAILKELIPD* |
Ga0137395_111359712 | 3300012917 | Vadose Zone Soil | PTITGVCTPACLLAASISVEAVTPPLVEMAMFKELLPD* |
Ga0163162_100420361 | 3300013306 | Switchgrass Rhizosphere | ILPTITGASTLACLLAASISVEAVTPPLVGMAFKEQDNRP* |
Ga0181524_102061023 | 3300014155 | Bog | LAIIILHAITGVCTPACLLAASISVEAVTPPLVGMGL* |
Ga0181521_103788413 | 3300014158 | Bog | IILHAITGVCTPACLLAASISVEAVTPPLVGMGL* |
Ga0181526_104906581 | 3300014200 | Bog | TITGVCTPACLLAASISVEAVTPPLVGLAILKELIPD* |
Ga0182018_100129351 | 3300014489 | Palsa | ILPTITGVCTPACLLAASISVEAVTPPLVGLAILKELLPD* |
Ga0182015_104795011 | 3300014495 | Palsa | AITGVCTPACLLAASISVEAVTPPLVGLAILKELTPD* |
Ga0182021_115726632 | 3300014502 | Fen | HSITGVCTPACLLAASISVEAVTPPLVGMAFKELLPI* |
Ga0132257_1006747362 | 3300015373 | Arabidopsis Rhizosphere | AIIILPTITGVCTPACLLAASISVEAVTPPLVGLALKDPLPI* |
Ga0187879_1000742511 | 3300017946 | Peatland | ILPTITGVCTPACLLAASISVEAVTPPLVGLAILKELLPD |
Ga0187879_100240541 | 3300017946 | Peatland | ILPTITGVCTPACLLAASISVEAVTPPLVGLAILKELIPD |
Ga0187782_111029811 | 3300017975 | Tropical Peatland | ILPTITGVCTPACLLAASISVEAVTPPLGGIGLAKNHFQTRV |
Ga0187857_100743301 | 3300018026 | Peatland | TITGVCTPACLLAASISVEAVTPPLVGLAILKELLPD |
Ga0187869_100279175 | 3300018030 | Peatland | IIILLTITGVCTPACLLAASISVEAVTPPLVGLAILKELLPD |
Ga0187863_100461553 | 3300018034 | Peatland | AIIILPTITGVCTPACLLAASISVEAVTPPLVGLAILKELIPD |
Ga0187862_103752411 | 3300018040 | Peatland | IILHAITGVCTPACLLAASISVESVTPPLVGWACKELSLF |
Ga0187871_100364995 | 3300018042 | Peatland | PTITGVCTPACLLAASISVEAVTPPLVGLAILKELLPD |
Ga0187859_100313011 | 3300018047 | Peatland | LAIIILHAITGVCTPACLLAASISVEAVTPPLVGIGL |
Ga0187771_100145571 | 3300018088 | Tropical Peatland | LAIIILHAITGVCTPACLLAASISVETVTPPLVGNGLVKDLLPD |
Ga0173479_107562821 | 3300019362 | Soil | LPTITGASTLACLLAASISVEAVTPPLVGLAHIKIYFNCRSGASGS |
Ga0182031_14134263 | 3300019787 | Bog | MPFVDGNYHLHAITGVCTPACLLAASISVEAVTPPLVDRPFKELLLFW |
Ga0210395_1000676210 | 3300020582 | Soil | LAIIILPTITGVCTPACLLAASISVEAVTPPLVGLAILKELIPD |
Ga0210405_101852853 | 3300021171 | Soil | AIIILHAITGVCTPACLLAASISVEAVTPPLVGWAFKELPVF |
Ga0210393_100803991 | 3300021401 | Soil | AIIILPTITGVCTPACLLAASISVEAVTPPLVGLAILKELVPD |
Ga0210387_103392222 | 3300021405 | Soil | IIILLTITGVCTPACLLAASISVEAVTPPLVGLAF |
Ga0210383_100640384 | 3300021407 | Soil | ITGVCTPACLLAASISVEAVTPPLVGLAILKELVPD |
Ga0193750_10433952 | 3300021413 | Soil | VWLAIVVLHAITGVCTPACLLAASISVEAVTPPLVGLAFKELLPI |
Ga0210391_1000058633 | 3300021433 | Soil | IILHAIAGVCTPACLLAASISVEAVTPPLVGLAGKELFPD |
Ga0212123_102721124 | 3300022557 | Iron-Sulfur Acid Spring | LLTITGVCTPACLLAASISVEAVTPPLVGLAVQKNYF |
Ga0208194_10087675 | 3300025412 | Peatland | TITGVCTPACLLAASISVEAVTPPLVGLAVLKELLPD |
Ga0207693_100002731 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IIILPTITGVCTPACLLAASISVEAVTPPLVGLAKLKELLPD |
Ga0209735_10099164 | 3300027562 | Forest Soil | IIILHAITGVCTPACLLAASISVEAVTPPLVGLAWKELLPD |
Ga0209420_10004891 | 3300027648 | Forest Soil | IIILPTITGVCTPACLLAASISVEAVTPPLVGLAILKELNPD |
Ga0209333_10017421 | 3300027676 | Forest Soil | AIIILHAITGVCTPACLLAASISVEAVTPPLVGLAILKELLPD |
Ga0209530_10743141 | 3300027692 | Forest Soil | IIILHAITGVCTPACLLAASISVEAVTPPLVGIGL |
Ga0209447_101314841 | 3300027701 | Bog Forest Soil | LAIIILSTITGVNTPACLLAVSISVEAVTPPLVGIGL |
Ga0209693_100675951 | 3300027855 | Soil | ITGVCTPACLLAASISVEAVTPPLVGLAILKELLPD |
Ga0209167_101456761 | 3300027867 | Surface Soil | IIILPTITGVCTPACLLAASISVEAVTPPLVGLAILKEPLPD |
Ga0209275_100291841 | 3300027884 | Soil | LAIIILPTITGVCTPACLLAASISVEAVTPPLVGLAILKELVPD |
Ga0209380_100039731 | 3300027889 | Soil | ITGVCTPACLLAASISVEAVTPPLVGLAILKELIPD |
Ga0209006_101323501 | 3300027908 | Forest Soil | AIIIVYAITGVYTPACLLAASISVEAVTPPLVGMACKDPLPD |
Ga0209006_101715361 | 3300027908 | Forest Soil | AIIILHAITGVCTPACLLAASISVEAVTPPLVGLAILKELPPD |
Ga0209698_1001802610 | 3300027911 | Watersheds | IIILPTITGVCTPACLLAASISVEAVTPPLVGLAGKELLPD |
Ga0209698_101260411 | 3300027911 | Watersheds | IIIFHAITGVWTPACLLAASISVEAVTPPLVGWPFKEQ |
Ga0302228_101393561 | 3300028808 | Palsa | VCAPACLLAASISVEAVTPPLMGLAILKELLQTRCET |
Ga0302277_11436261 | 3300029982 | Bog | AIIILHAITGVCTPACLLAASISVEAVTPPLVGLAIKF |
Ga0311338_100524841 | 3300030007 | Palsa | IIVYAITGVYTPACLLAASISVEAVTPPLVGWPILKELIPD |
Ga0302192_100712863 | 3300030507 | Bog | IIILHAITGVCTPACLLAASISVEAVTPPLVGLAIKF |
Ga0302325_105108242 | 3300031234 | Palsa | ILLTITGVCTPACLLAASISVEAVTPPLVGMAIVKELAQS |
Ga0302325_110268561 | 3300031234 | Palsa | ITGVCTPACLLAASISVEAVTPPLVGLAILKELLLD |
Ga0302324_1006629903 | 3300031236 | Palsa | AIIILHAITGVCTPACLLAASISVEAVTPPLCGMDL |
Ga0265316_106996311 | 3300031344 | Rhizosphere | TGVCTPACLLAASISVEAVTPPLVGLAILKELLPD |
Ga0302326_103784431 | 3300031525 | Palsa | IIILHAITGVCTPACLLAASISVEAVTPPLCGMDL |
Ga0302326_109980333 | 3300031525 | Palsa | IILHAITGVCAPACLLAASISVEAVTPPLVGLAILKELLQTRCET |
Ga0307471_1002229373 | 3300032180 | Hardwood Forest Soil | LAIIILPTITGVCTPACLLAASISVEAVTPPLVGLAYKDPLPA |
Ga0370546_073089_458_565 | 3300034681 | Soil | MAIVVLHAITGVCTPACLLAASISVEAVTPPLVGLA |
⦗Top⦘ |