Scaffold Ga0182025_1227318

Overview

Basic Information

• Taxon OID: 3300019786
• Scaffold ID: Ga0182025_1227318
• Source Dataset Name: Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2051
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Stordalen
• Coordinates
  • Lat. (^o): 68.35
  • Long. (^o): 19.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074487	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182025_12273183	F074487	N/A	MTCVAVIVVLSVIPSTRTGSPLVTALAEAELVPFSYAVEDVSLTVAF