NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181359_1074717

Scaffold Ga0181359_1074717


Overview

Basic Information
Taxon OID3300019784 Open in IMG/M
Scaffold IDGa0181359_1074717 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1279
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.1881Long. (o)-86.344Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009679Metagenome / Metatranscriptome314Y
F009746Metagenome / Metatranscriptome313N
F052591Metagenome / Metatranscriptome142Y

Sequences

Protein IDFamilyRBSSequence
Ga0181359_10747171F009746GAGGLGNLATYRDTLAATLAAAGRVVYSFPNENITPPAIVLVPGSPYITVSAIGGARCNVRFDITVIVNAADNRAALANIETLIFSVTDLLANNISFLSGWSQPTVQQIGNAEMLISQLNIEMVTTN
Ga0181359_10747172F009679AGGAMALITLAELKSVLGIGDIYADAIVQACADSAENIILSYLTFDDVSIKEVQLTSNVARFYCYDNTFVVGQALTVTGCNSPFNGSRTVTAVGTDNQVTFFEAAITNADITRRMVIPNGRAVLTSQATLYDTTPEVREAALAVACDIWITRTGTLGQQGVDFQSPAPYRLGRSMLTRVSGLLGKHLDTRGYLG
Ga0181359_10747173F052591N/AASSVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.