Basic Information | |
---|---|
Family ID | F052591 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 142 |
Average Sequence Length | 43 residues |
Representative Sequence | IYESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 142 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.89 % |
% of genes from short scaffolds (< 2000 bps) | 92.25 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (81.690 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.873 % of family members) |
Environment Ontology (ENVO) | Unclassified (58.451 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.859 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.85% β-sheet: 0.00% Coil/Unstructured: 59.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 142 Family Scaffolds |
---|---|---|
PF07486 | Hydrolase_2 | 0.70 |
PF01551 | Peptidase_M23 | 0.70 |
PF01844 | HNH | 0.70 |
COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
---|---|---|---|
COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.37 % |
Unclassified | root | N/A | 5.63 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001523|JGI1221J15618_1164777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2720 | Open in IMG/M |
3300002202|metazooDRAFT_1257763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300003277|JGI25908J49247_10158756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300004769|Ga0007748_10014755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300005580|Ga0049083_10324854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300005584|Ga0049082_10231320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300006037|Ga0075465_10104018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300006484|Ga0070744_10028079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1666 | Open in IMG/M |
3300006484|Ga0070744_10144270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
3300006484|Ga0070744_10210988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300006805|Ga0075464_11101591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300006920|Ga0070748_1322282 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 548 | Open in IMG/M |
3300007234|Ga0075460_10128996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300007520|Ga0105054_10988276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300007538|Ga0099851_1184290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300007559|Ga0102828_1067219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300007708|Ga0102859_1157894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300007972|Ga0105745_1058130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
3300009081|Ga0105098_10275900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
3300009155|Ga0114968_10174513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1260 | Open in IMG/M |
3300009158|Ga0114977_10187448 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1218 | Open in IMG/M |
3300009159|Ga0114978_10245439 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1114 | Open in IMG/M |
3300009159|Ga0114978_10444147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
3300009159|Ga0114978_10603754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300009160|Ga0114981_10091513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1689 | Open in IMG/M |
3300009160|Ga0114981_10146298 | Not Available | 1304 | Open in IMG/M |
3300009165|Ga0105102_10263816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
3300009180|Ga0114979_10095364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1842 | Open in IMG/M |
3300009180|Ga0114979_10598701 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 630 | Open in IMG/M |
3300009180|Ga0114979_10723961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300009181|Ga0114969_10763176 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 515 | Open in IMG/M |
3300009183|Ga0114974_10198406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1227 | Open in IMG/M |
3300009183|Ga0114974_10281154 | Not Available | 985 | Open in IMG/M |
3300010316|Ga0136655_1118903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300010368|Ga0129324_10388704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300010368|Ga0129324_10431617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300012013|Ga0153805_1048741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300012714|Ga0157601_1135771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10598312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10506533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10415845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
3300013295|Ga0170791_10932622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1780 | Open in IMG/M |
3300013295|Ga0170791_12254654 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 679 | Open in IMG/M |
3300013295|Ga0170791_15201894 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1292 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10594270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300014811|Ga0119960_1041665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300017701|Ga0181364_1008036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1801 | Open in IMG/M |
3300017716|Ga0181350_1050994 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1099 | Open in IMG/M |
3300017716|Ga0181350_1093635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
3300017723|Ga0181362_1053526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
3300017723|Ga0181362_1075704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300017736|Ga0181365_1016878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1835 | Open in IMG/M |
3300017766|Ga0181343_1219200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300017777|Ga0181357_1164526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
3300017777|Ga0181357_1207341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300017777|Ga0181357_1220031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300017777|Ga0181357_1334490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300017778|Ga0181349_1008644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4259 | Open in IMG/M |
3300017778|Ga0181349_1232985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300017780|Ga0181346_1247210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300017784|Ga0181348_1178806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
3300017784|Ga0181348_1244616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300017785|Ga0181355_1277870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300017785|Ga0181355_1373435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300019784|Ga0181359_1074717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1279 | Open in IMG/M |
3300019784|Ga0181359_1090394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1135 | Open in IMG/M |
3300019784|Ga0181359_1136918 | Not Available | 857 | Open in IMG/M |
3300019784|Ga0181359_1262944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300020220|Ga0194119_10092819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2425 | Open in IMG/M |
3300020554|Ga0208599_1045467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300021325|Ga0210301_1056406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300021961|Ga0222714_10495944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300021962|Ga0222713_10015514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6598 | Open in IMG/M |
3300021962|Ga0222713_10264909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1112 | Open in IMG/M |
3300021962|Ga0222713_10370405 | Not Available | 890 | Open in IMG/M |
3300021963|Ga0222712_10208504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1274 | Open in IMG/M |
3300021963|Ga0222712_10476920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
3300022190|Ga0181354_1088245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
3300022190|Ga0181354_1249439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300022407|Ga0181351_1088075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1223 | Open in IMG/M |
3300022407|Ga0181351_1188661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300022748|Ga0228702_1028156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1735 | Open in IMG/M |
3300022752|Ga0214917_10068222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2255 | Open in IMG/M |
3300024346|Ga0244775_11340711 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 552 | Open in IMG/M |
3300025646|Ga0208161_1094856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300025687|Ga0208019_1124431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
3300025818|Ga0208542_1159500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300025896|Ga0208916_10335203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300027129|Ga0255067_1022676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
3300027152|Ga0255100_1097727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300027156|Ga0255078_1051631 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 828 | Open in IMG/M |
3300027213|Ga0208555_1004282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2179 | Open in IMG/M |
3300027486|Ga0255086_1031929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
3300027600|Ga0255117_1022896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1385 | Open in IMG/M |
3300027656|Ga0209357_1111904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
3300027679|Ga0209769_1083559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
3300027679|Ga0209769_1105945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
3300027707|Ga0209443_1240980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300027732|Ga0209442_1321003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300027736|Ga0209190_1176141 | Not Available | 902 | Open in IMG/M |
3300027744|Ga0209355_1033791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2564 | Open in IMG/M |
3300027754|Ga0209596_1334706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300027756|Ga0209444_10329672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300027763|Ga0209088_10012962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4447 | Open in IMG/M |
3300027763|Ga0209088_10319791 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 623 | Open in IMG/M |
3300027764|Ga0209134_10135163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300027764|Ga0209134_10248698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
3300027797|Ga0209107_10202429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
3300027798|Ga0209353_10056551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1799 | Open in IMG/M |
3300027798|Ga0209353_10336107 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 633 | Open in IMG/M |
3300027808|Ga0209354_10243942 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 722 | Open in IMG/M |
3300027848|Ga0209390_10723878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300027892|Ga0209550_10684601 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 592 | Open in IMG/M |
3300027900|Ga0209253_11011832 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 573 | Open in IMG/M |
3300028298|Ga0268280_1202680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300031746|Ga0315293_10773896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300031772|Ga0315288_10682391 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 972 | Open in IMG/M |
3300031787|Ga0315900_10426486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1035 | Open in IMG/M |
3300031857|Ga0315909_10189617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1642 | Open in IMG/M |
3300031857|Ga0315909_10723281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300031885|Ga0315285_10668689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300031997|Ga0315278_11771033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300032018|Ga0315272_10498305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300032050|Ga0315906_10351892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1303 | Open in IMG/M |
3300032053|Ga0315284_12251112 | Not Available | 541 | Open in IMG/M |
3300032462|Ga0335396_10849441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300032516|Ga0315273_10775016 | All Organisms → Viruses → Predicted Viral | 1252 | Open in IMG/M |
3300033980|Ga0334981_0234329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
3300033994|Ga0334996_0316932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
3300033994|Ga0334996_0320971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300033996|Ga0334979_0431992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300034013|Ga0334991_0258553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300034050|Ga0335023_0427650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300034120|Ga0335056_0396582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300034122|Ga0335060_0491939 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 633 | Open in IMG/M |
3300034167|Ga0335017_0366148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300034272|Ga0335049_0005839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9148 | Open in IMG/M |
3300034283|Ga0335007_0577250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300034283|Ga0335007_0726608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300034284|Ga0335013_0550135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.87% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.38% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.97% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.34% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.63% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.93% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.52% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.82% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.82% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.11% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.11% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.11% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.41% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.41% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.70% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.70% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.70% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.70% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.70% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.70% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.70% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.70% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.70% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.70% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001523 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007520 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly) | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021325 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027152 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8d | Environmental | Open in IMG/M |
3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027486 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027848 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300028298 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1221J15618_11647777 | 3300001523 | Hypersaline | VAIYESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT* |
metazooDRAFT_12577632 | 3300002202 | Lake | AFICVPSAIAIYESPVLRLSTNVVTSGEIETMIYGYLATKTLVSGGLRRFNMTA* |
JGI25908J49247_101587562 | 3300003277 | Freshwater Lake | PVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT* |
Ga0007748_100147552 | 3300004769 | Freshwater Lake | VAIMESPVLQLSTNIITTGEIETMLYGYMAVKTLVAGGVRRFNLT* |
Ga0049083_103248542 | 3300005580 | Freshwater Lentic | IVPSSVVVYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT* |
Ga0049082_102313202 | 3300005584 | Freshwater Lentic | SVSIYESPILRLSVNQPASGEIETALYGYMAAGVLVAGGVRRFNLT* |
Ga0075465_101040181 | 3300006037 | Aqueous | LSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA* |
Ga0070744_100280795 | 3300006484 | Estuarine | IYESPVLRLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA* |
Ga0070744_101442701 | 3300006484 | Estuarine | LRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNMTA* |
Ga0070744_102109882 | 3300006484 | Estuarine | PILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT* |
Ga0075464_111015912 | 3300006805 | Aqueous | IVPSSMYIAESPVLRLSTNIPTSGEIETMLYGYIAAKTLVSGGIRRFNLT* |
Ga0070748_13222822 | 3300006920 | Aqueous | LSTNVVTTGEIETMLYGYMAVKTVVAGGVRRFNLT* |
Ga0075460_101289963 | 3300007234 | Aqueous | MSTNVVANGQIETMLYGYLACGVLVAGGVRRFNLT* |
Ga0105054_109882761 | 3300007520 | Freshwater | IYESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT* |
Ga0099851_11842902 | 3300007538 | Aqueous | SAFIVTPSAVAIYESPVLRMSTNVVTSGEIETMLYGYLACGVLVAGGVRRFNLT* |
Ga0102828_10672191 | 3300007559 | Estuarine | SPILRLSVNQPASGEIETALYGYMAAGVLVAGGVRRYNLT* |
Ga0102859_11578942 | 3300007708 | Estuarine | STNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT* |
Ga0105745_10581301 | 3300007972 | Estuary Water | VAIYESPVLQLSTNIVTTGEIETMLYGYMAVKTITAGGVRRFNLT* |
Ga0105098_102759002 | 3300009081 | Freshwater Sediment | YESPILRMSTNHVASGEIETMLYGYLAVGVLTAGGVRRFNLT* |
Ga0114968_101745131 | 3300009155 | Freshwater Lake | VLRLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA* |
Ga0114977_101874483 | 3300009158 | Freshwater Lake | VAIMESPVLQLSTNVVSTGEIETMLYGYLAVKTLVAGGVRRFNLT* |
Ga0114978_102454393 | 3300009159 | Freshwater Lake | LATNVVTSGEIEIMLYGYLATGVLVAGGVRRYNLT* |
Ga0114978_104441472 | 3300009159 | Freshwater Lake | PVLRLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA* |
Ga0114978_106037542 | 3300009159 | Freshwater Lake | SAFIVVPSSVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS* |
Ga0114981_100915135 | 3300009160 | Freshwater Lake | IVVPSSVAIYESPVLRMSTNVVTTGEIETSIYGYMAAGVLVAGGVRRFNLT* |
Ga0114981_101462984 | 3300009160 | Freshwater Lake | AIYESPVLRLSTNTPTTGEIETALYGYMAAGVVVAGGVRRFNLT* |
Ga0105102_102638163 | 3300009165 | Freshwater Sediment | MSTNVVTSGEIETMLYGYLAVGVLTAGGVRRFNLT* |
Ga0114979_100953641 | 3300009180 | Freshwater Lake | RLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA* |
Ga0114979_105987011 | 3300009180 | Freshwater Lake | LQLSTNVVSTGEIETMLYGYLAVKTLVAGGVRRFNLT* |
Ga0114979_107239611 | 3300009180 | Freshwater Lake | RMQTNIASTGEIETMLYGYLAVGVLVSGGVRRFNLT* |
Ga0114969_107631762 | 3300009181 | Freshwater Lake | PVLQLSTNVVTTGEIETMLYGYMAVKTVVAGGVRRFNLT* |
Ga0114974_101984061 | 3300009183 | Freshwater Lake | PSSVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS* |
Ga0114974_102811542 | 3300009183 | Freshwater Lake | VVPSSMYIAESPVLRLSTNIPTSGEIETMLYGYIAAKTLVSGGIRRFNLT* |
Ga0136655_11189032 | 3300010316 | Freshwater To Marine Saline Gradient | SAVAIYESPILRMSTNVVTSGEIETMLYGYLAVGVLTAGGVRRFNLT* |
Ga0129324_103887041 | 3300010368 | Freshwater To Marine Saline Gradient | AFIVVPSSVAIYESPVLQLSTNVVTTGEIETMLYGYMAVKTITAGGVRRFNLT* |
Ga0129324_104316172 | 3300010368 | Freshwater To Marine Saline Gradient | VSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLT* |
Ga0153805_10487411 | 3300012013 | Surface Ice | VPSAVSIYESPILRLSTNIPTSGEIETSLYGYMAVGVLVSGGVRRFNLT* |
Ga0157601_11357711 | 3300012714 | Freshwater | IYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLT* |
(restricted) Ga0172367_105983121 | 3300013126 | Freshwater | IIYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT* |
(restricted) Ga0172372_105065331 | 3300013132 | Freshwater | IIYESPILRLSTNVVVSGEIETMIYGYLATKVLVAGGVRRFNLT* |
(restricted) Ga0172362_104158453 | 3300013133 | Sediment | SPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT* |
Ga0170791_109326221 | 3300013295 | Freshwater | VSIYESPILRLSVNQPATGEIETALYGYMATGVLVAGGVRRFNLT* |
Ga0170791_122546542 | 3300013295 | Freshwater | VPSAVAIYESPVLQLSTNVVTTGEIETMLYGYMAVKTVVAGGVRRFNLT* |
Ga0170791_152018941 | 3300013295 | Freshwater | VPSSVAIYESPTLQLATNVVTSGEIEIMLYGYLATGVLVAGGVRRYNLT* |
(restricted) Ga0172376_105942701 | 3300014720 | Freshwater | LSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT* |
Ga0119960_10416651 | 3300014811 | Aquatic | VSQSRSICASPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS* |
Ga0181364_10080365 | 3300017701 | Freshwater Lake | PSAVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKTLVAGGVRRFNLT |
Ga0181350_10509941 | 3300017716 | Freshwater Lake | PSSVAIMESPVLQLSTNIITTGEIETMLYGYMAVKTLVAGGVRRFNLT |
Ga0181350_10936352 | 3300017716 | Freshwater Lake | RLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT |
Ga0181362_10535261 | 3300017723 | Freshwater Lake | PSSVSIYESPILRLSVNQPASGEIETALYGYMAAGVLVAGGVRRFNLT |
Ga0181362_10757042 | 3300017723 | Freshwater Lake | VVPSSVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT |
Ga0181365_10168785 | 3300017736 | Freshwater Lake | FIVVPSAVAIYESPVLQLSTNVPTSGEIETMLYGYLAVKTLVAGGVRRFNLT |
Ga0181343_12192001 | 3300017766 | Freshwater Lake | SPVLQLSTNVVTTGEIETMLYGYMAVKTIVAGGVRRFNLT |
Ga0181357_11645262 | 3300017777 | Freshwater Lake | VYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT |
Ga0181357_12073411 | 3300017777 | Freshwater Lake | SAFIVVPSSVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT |
Ga0181357_12200311 | 3300017777 | Freshwater Lake | RLSVNQPASGEIETALYGYMAAGVLVAGGVRRFNLT |
Ga0181357_13344902 | 3300017777 | Freshwater Lake | FIVVPSSVIIYESPILRLSTNVVTSGEIETMIYGYMATKVLVAGGVRRFNMT |
Ga0181349_10086441 | 3300017778 | Freshwater Lake | AFIVTPSAVAIYESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT |
Ga0181349_12329851 | 3300017778 | Freshwater Lake | IIVPSSVVVYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT |
Ga0181346_12472101 | 3300017780 | Freshwater Lake | SPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT |
Ga0181348_11788061 | 3300017784 | Freshwater Lake | SIYESPILRLSTNIPTTGEIETSLYGYMAVGVLVQGGVRRFNLT |
Ga0181348_12446161 | 3300017784 | Freshwater Lake | PVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT |
Ga0181355_12778701 | 3300017785 | Freshwater Lake | IYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT |
Ga0181355_13734352 | 3300017785 | Freshwater Lake | IYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS |
Ga0181359_10747173 | 3300019784 | Freshwater Lake | ASSVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT |
Ga0181359_10903943 | 3300019784 | Freshwater Lake | RIRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT |
Ga0181359_11369183 | 3300019784 | Freshwater Lake | RQLSTNVPTSGEIETMLYGYLAVKTLVAGGVRRFNLT |
Ga0181359_12629442 | 3300019784 | Freshwater Lake | LSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT |
Ga0194119_100928191 | 3300020220 | Freshwater Lake | ILRLSTNVVVSGEIETMVYGYLATKVLVAGGVRRFNLT |
Ga0208599_10454671 | 3300020554 | Freshwater | VVPSSVSIYESPILRLSTNIPTSGEIETSLYGYMAVGVLVQGGVRRFNLT |
Ga0210301_10564061 | 3300021325 | Estuarine | SSVAIYESPILRMSTNVVTTGEIETALYGYLAVGVLVAGGVRRFNMTA |
Ga0222714_104959442 | 3300021961 | Estuarine Water | LRLGTNVPTSGEIELMLYGYLATKTLVSGGLQRYNLT |
Ga0222713_100155141 | 3300021962 | Estuarine Water | LRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNMTA |
Ga0222713_102649091 | 3300021962 | Estuarine Water | IVVPSAVSIYESPTLRLSTNIPTSGEIETALYGYMAVGVLVAGGVRRFNLT |
Ga0222713_103704051 | 3300021962 | Estuarine Water | IYESPTLRLSTNIPTSGEIETSLYGYMAVGVLVAGGVRRFNLT |
Ga0222712_102085043 | 3300021963 | Estuarine Water | VLRLSTNVPTSGEIELMLYGYLATKTLVSTGLQRYNMTA |
Ga0222712_104769202 | 3300021963 | Estuarine Water | ESPVLRLSTNVPVSGEIETMLYGYLATKTLVAGGLRRFNLT |
Ga0222712_106057061 | 3300021963 | Estuarine Water | ILQLQTNVPTSGEIEIELFGFMAVKTLIATGLQRYNLT |
Ga0181354_10882453 | 3300022190 | Freshwater Lake | VSIYESPILRLSTNIPTSGEIETSLYGYMAVGVLVAGGVRRFNLT |
Ga0181354_12494392 | 3300022190 | Freshwater Lake | IIVYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT |
Ga0181351_10880753 | 3300022407 | Freshwater Lake | RRKENQPASGEIETALYGYMAAGVLVAGGVRRFNLT |
Ga0181351_11886611 | 3300022407 | Freshwater Lake | VVVYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT |
Ga0228702_10281565 | 3300022748 | Freshwater | LRLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA |
Ga0214917_100682221 | 3300022752 | Freshwater | SPVLRLSTNVPTSGEIELMLYGYMATKTLVSGGLQRYNMTA |
Ga0214919_1000804022 | 3300023184 | Freshwater | YESQILQLSTNTPTSGEIEVELFGFLATKTLIATGLQRYNLT |
Ga0244775_113407112 | 3300024346 | Estuarine | SSVAIYESPTLQLATNVVTSGEIEIMLYGYLATGVLVAGGVRRYNLT |
Ga0208161_10948561 | 3300025646 | Aqueous | ESPILRLSTNIPTSGEIETSLYGYMAVGVLVAGGVRRFNLT |
Ga0208019_11244312 | 3300025687 | Aqueous | IVVPSSVSIYESPILRLSTNIPTSGEIETSLYGYMAVGVLVAGGVRRFNLT |
Ga0208542_11595002 | 3300025818 | Aqueous | MSTNVVANGQIETMLYGYLACGVLVAGGVRRFNLT |
Ga0208916_103352031 | 3300025896 | Aqueous | AIYESPVLRLSTNVPTSGEIETMLYGYLATKTLVAGGLRRFNLT |
Ga0255067_10226763 | 3300027129 | Freshwater | STNVPTSGEIELMLYGYLATKTLVSGGLQRFNMTA |
Ga0255100_10977271 | 3300027152 | Freshwater | IYESPTLQLATNVVTSGEIEIMLYGYLATGVLVAGGVRRFNLT |
Ga0255078_10516311 | 3300027156 | Freshwater | PSSVAIYESPTLQLATNVVTSGEIEIMLYGYLATGVLVAGGVRRYNLT |
Ga0208555_10042821 | 3300027213 | Estuarine | VLQLSTNIITTGEIETMLYGYMAVKTLVAGGVRRFNLT |
Ga0255086_10319291 | 3300027486 | Freshwater | VLRLSTNVVTSGEIETMIYGYLATKTLVSGGLRRFNLT |
Ga0255117_10228961 | 3300027600 | Freshwater | AFIVVPSAVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT |
Ga0209357_11119041 | 3300027656 | Freshwater Lake | LRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS |
Ga0209769_10835593 | 3300027679 | Freshwater Lake | ESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT |
Ga0209769_11059451 | 3300027679 | Freshwater Lake | VPSSVSIYESPILRLSVNQPASGEIETALYGYMAAGVLVAGGVRRFNLT |
Ga0209443_12409801 | 3300027707 | Freshwater Lake | SPALQLSTNVPSTGEIETELFGFIAVKTLVSTGLQRYNMTA |
Ga0209442_13210031 | 3300027732 | Freshwater Lake | AFIIVPSSVVIYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT |
Ga0209190_11761411 | 3300027736 | Freshwater Lake | AFIVVPSSVAIYESPVLRLSTNTPTTGEIETALYGYMATGVLVAGGVRRFNLT |
Ga0209355_10337911 | 3300027744 | Freshwater Lake | PSSVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT |
Ga0209596_13347062 | 3300027754 | Freshwater Lake | AIAIYESPVLRLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA |
Ga0209444_103296722 | 3300027756 | Freshwater Lake | PILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT |
Ga0209088_100129621 | 3300027763 | Freshwater Lake | RLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA |
Ga0209088_103197912 | 3300027763 | Freshwater Lake | LSTNVVSTGEIETMLYGYLAVKTLVAGGVRRFNLT |
Ga0209134_101351632 | 3300027764 | Freshwater Lake | VLQLSTNIVTTGEIETMLYGYLAVKVVTAGGVRRFNLT |
Ga0209134_102486982 | 3300027764 | Freshwater Lake | ILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS |
Ga0209107_102024293 | 3300027797 | Freshwater And Sediment | SSVAIYESPVLQLSTNVVTTGEIETMLYGYLATKVIVAGGVRRFNLT |
Ga0209353_100565511 | 3300027798 | Freshwater Lake | ESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT |
Ga0209353_103361072 | 3300027798 | Freshwater Lake | IMESPVLQLSTNIITTGEIETMLYGYLAVKTLVAGGVRRYNLT |
Ga0209354_102439421 | 3300027808 | Freshwater Lake | SAVAIMESPVLQLSTNIITTGEIETMLYGYLAVKTLVAGGVRRYNLT |
Ga0209390_107238781 | 3300027848 | Freshwater | YESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT |
Ga0209550_106846011 | 3300027892 | Freshwater Lake | SVAIMESPVLQLSTNIITTGEIETMLYGYMAVKTLVAGGVRRFNLT |
Ga0209253_110118321 | 3300027900 | Freshwater Lake Sediment | ESPVLRLSTNTPTTGEIETALYGYMATGVLVAGGVRRFNLT |
Ga0268280_12026801 | 3300028298 | Saline Water | SSVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS |
Ga0315293_107738961 | 3300031746 | Sediment | PILRMSTNVVTSGEIETMLYGYLACGVLVAGGVRRFNLT |
Ga0315288_106823911 | 3300031772 | Sediment | AVAIMESPVLQLSTNVVSTGEIETMLYGYLAVKTLVAGGVRRFNLT |
Ga0315900_104264861 | 3300031787 | Freshwater | RLSTNIPTSGEIETSLYGYMAVGVLVQGGVRRFNLT |
Ga0315909_101896171 | 3300031857 | Freshwater | PSSVAIYESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT |
Ga0315909_107232812 | 3300031857 | Freshwater | AFIVVPSSVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS |
Ga0315285_106686891 | 3300031885 | Sediment | RLSTNIPTSGEIELMLYGYLATKTLVSGGLQRYNMT |
Ga0315278_117710331 | 3300031997 | Sediment | AIAIYESPVLRLSTNIPTSGEIELMLYGYLATKTLVSGGLQRYNMTA |
Ga0315272_104983051 | 3300032018 | Sediment | PVLRLSTNIPTSGEIELMLYGYLATKTLVSGGLQRYNMTA |
Ga0315906_103518921 | 3300032050 | Freshwater | PILRLSTNIPTSGEIETSLYGYMAVGVLVQGGVRRFNLT |
Ga0315284_122511122 | 3300032053 | Sediment | IAIYESPVLKLSTNIPASGEISTMLYGYLATKTLVSGGLRRFNV |
Ga0335396_108494412 | 3300032462 | Freshwater | PLLRMSTNVVTSGEIETMLYGYMAVGVLVAGGVRRFNLT |
Ga0315273_107750161 | 3300032516 | Sediment | VLRLGTNIPTSGEIELSLYGYLATKTLVSGGLQRYNMTA |
Ga0334981_0234329_2_139 | 3300033980 | Freshwater | VSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLT |
Ga0334996_0316932_1_156 | 3300033994 | Freshwater | IVTPSSVAIYESPILRLSTNHVASGEIETMLYGYLAVGVLTAGGVRRFNLT |
Ga0334996_0320971_2_139 | 3300033994 | Freshwater | VAIYESPILRMSTNVVTTGEIETALYGYLAVGVLTAGGVRRFNLT |
Ga0334979_0431992_3_170 | 3300033996 | Freshwater | ESAFIVTPSAVAIYESPILRMSTNVVTSGEIETALYGYLAVGVLTAGGVRRFNLS |
Ga0334991_0258553_603_710 | 3300034013 | Freshwater | MSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT |
Ga0335023_0427650_3_158 | 3300034050 | Freshwater | IVVPSSVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLT |
Ga0335056_0396582_615_743 | 3300034120 | Freshwater | YESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT |
Ga0335060_0491939_472_633 | 3300034122 | Freshwater | AFIVVPSSVAIYESPVLQLSTNVVTTGEIETMLYGYMAVKTVVAGGVRRFNLT |
Ga0335017_0366148_668_787 | 3300034167 | Freshwater | PILRLSTNIPTSGEIETALYGYMAVGVLVQGGVRRFNLT |
Ga0335049_0005839_3_113 | 3300034272 | Freshwater | RLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS |
Ga0335007_0577250_519_656 | 3300034283 | Freshwater | VAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT |
Ga0335007_0726608_1_141 | 3300034283 | Freshwater | AVSIYESPILRLSTNIPTSGEIETSLYGYMAVGVLVQGGVRRFNLT |
Ga0335013_0550135_2_151 | 3300034284 | Freshwater | VPSSVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS |
⦗Top⦘ |