NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F052591

Metagenome / Metatranscriptome Family F052591

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052591
Family Type Metagenome / Metatranscriptome
Number of Sequences 142
Average Sequence Length 43 residues
Representative Sequence IYESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT
Number of Associated Samples 107
Number of Associated Scaffolds 142

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.89 %
% of genes from short scaffolds (< 2000 bps) 92.25 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (81.690 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(28.873 % of family members)
Environment Ontology (ENVO) Unclassified
(58.451 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(59.859 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 40.85%    β-sheet: 0.00%    Coil/Unstructured: 59.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 142 Family Scaffolds
PF07486Hydrolase_2 0.70
PF01551Peptidase_M23 0.70
PF01844HNH 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 142 Family Scaffolds
COG3773Cell wall hydrolase CwlJ, involved in spore germinationCell cycle control, cell division, chromosome partitioning [D] 0.70


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.37 %
UnclassifiedrootN/A5.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001523|JGI1221J15618_1164777All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2720Open in IMG/M
3300002202|metazooDRAFT_1257763All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage661Open in IMG/M
3300003277|JGI25908J49247_10158756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300004769|Ga0007748_10014755All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300005580|Ga0049083_10324854All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300005584|Ga0049082_10231320All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300006037|Ga0075465_10104018All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage630Open in IMG/M
3300006484|Ga0070744_10028079All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1666Open in IMG/M
3300006484|Ga0070744_10144270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage683Open in IMG/M
3300006484|Ga0070744_10210988All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300006805|Ga0075464_11101591All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300006920|Ga0070748_1322282All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii548Open in IMG/M
3300007234|Ga0075460_10128996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage892Open in IMG/M
3300007520|Ga0105054_10988276All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage587Open in IMG/M
3300007538|Ga0099851_1184290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage765Open in IMG/M
3300007559|Ga0102828_1067219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage847Open in IMG/M
3300007708|Ga0102859_1157894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300007972|Ga0105745_1058130All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1075Open in IMG/M
3300009081|Ga0105098_10275900All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage800Open in IMG/M
3300009155|Ga0114968_10174513All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1260Open in IMG/M
3300009158|Ga0114977_10187448All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii1218Open in IMG/M
3300009159|Ga0114978_10245439All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii1114Open in IMG/M
3300009159|Ga0114978_10444147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage770Open in IMG/M
3300009159|Ga0114978_10603754All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300009160|Ga0114981_10091513All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1689Open in IMG/M
3300009160|Ga0114981_10146298Not Available1304Open in IMG/M
3300009165|Ga0105102_10263816All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage881Open in IMG/M
3300009180|Ga0114979_10095364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1842Open in IMG/M
3300009180|Ga0114979_10598701All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii630Open in IMG/M
3300009180|Ga0114979_10723961All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300009181|Ga0114969_10763176All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii515Open in IMG/M
3300009183|Ga0114974_10198406All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1227Open in IMG/M
3300009183|Ga0114974_10281154Not Available985Open in IMG/M
3300010316|Ga0136655_1118903All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage793Open in IMG/M
3300010368|Ga0129324_10388704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300010368|Ga0129324_10431617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300012013|Ga0153805_1048741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage719Open in IMG/M
3300012714|Ga0157601_1135771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
(restricted) 3300013126|Ga0172367_10598312All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
(restricted) 3300013132|Ga0172372_10506533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage798Open in IMG/M
(restricted) 3300013133|Ga0172362_10415845All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage933Open in IMG/M
3300013295|Ga0170791_10932622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1780Open in IMG/M
3300013295|Ga0170791_12254654All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii679Open in IMG/M
3300013295|Ga0170791_15201894All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii1292Open in IMG/M
(restricted) 3300014720|Ga0172376_10594270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300014811|Ga0119960_1041665All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage724Open in IMG/M
3300017701|Ga0181364_1008036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1801Open in IMG/M
3300017716|Ga0181350_1050994All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii1099Open in IMG/M
3300017716|Ga0181350_1093635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage747Open in IMG/M
3300017723|Ga0181362_1053526All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage836Open in IMG/M
3300017723|Ga0181362_1075704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage681Open in IMG/M
3300017736|Ga0181365_1016878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1835Open in IMG/M
3300017766|Ga0181343_1219200All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300017777|Ga0181357_1164526All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage810Open in IMG/M
3300017777|Ga0181357_1207341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage697Open in IMG/M
3300017777|Ga0181357_1220031All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage670Open in IMG/M
3300017777|Ga0181357_1334490All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300017778|Ga0181349_1008644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4259Open in IMG/M
3300017778|Ga0181349_1232985All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300017780|Ga0181346_1247210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage625Open in IMG/M
3300017784|Ga0181348_1178806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage775Open in IMG/M
3300017784|Ga0181348_1244616All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage623Open in IMG/M
3300017785|Ga0181355_1277870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage635Open in IMG/M
3300017785|Ga0181355_1373435All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300019784|Ga0181359_1074717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1279Open in IMG/M
3300019784|Ga0181359_1090394All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1135Open in IMG/M
3300019784|Ga0181359_1136918Not Available857Open in IMG/M
3300019784|Ga0181359_1262944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300020220|Ga0194119_10092819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2425Open in IMG/M
3300020554|Ga0208599_1045467All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage641Open in IMG/M
3300021325|Ga0210301_1056406All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300021961|Ga0222714_10495944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage628Open in IMG/M
3300021962|Ga0222713_10015514All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6598Open in IMG/M
3300021962|Ga0222713_10264909All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1112Open in IMG/M
3300021962|Ga0222713_10370405Not Available890Open in IMG/M
3300021963|Ga0222712_10208504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1274Open in IMG/M
3300021963|Ga0222712_10476920All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage743Open in IMG/M
3300022190|Ga0181354_1088245All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1018Open in IMG/M
3300022190|Ga0181354_1249439All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300022407|Ga0181351_1088075All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1223Open in IMG/M
3300022407|Ga0181351_1188661All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage701Open in IMG/M
3300022748|Ga0228702_1028156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1735Open in IMG/M
3300022752|Ga0214917_10068222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2255Open in IMG/M
3300024346|Ga0244775_11340711All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii552Open in IMG/M
3300025646|Ga0208161_1094856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage834Open in IMG/M
3300025687|Ga0208019_1124431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage758Open in IMG/M
3300025818|Ga0208542_1159500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300025896|Ga0208916_10335203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300027129|Ga0255067_1022676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage923Open in IMG/M
3300027152|Ga0255100_1097727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300027156|Ga0255078_1051631All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii828Open in IMG/M
3300027213|Ga0208555_1004282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2179Open in IMG/M
3300027486|Ga0255086_1031929All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage909Open in IMG/M
3300027600|Ga0255117_1022896All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1385Open in IMG/M
3300027656|Ga0209357_1111904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage760Open in IMG/M
3300027679|Ga0209769_1083559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1044Open in IMG/M
3300027679|Ga0209769_1105945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage907Open in IMG/M
3300027707|Ga0209443_1240980All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage621Open in IMG/M
3300027732|Ga0209442_1321003All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300027736|Ga0209190_1176141Not Available902Open in IMG/M
3300027744|Ga0209355_1033791All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2564Open in IMG/M
3300027754|Ga0209596_1334706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage590Open in IMG/M
3300027756|Ga0209444_10329672All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300027763|Ga0209088_10012962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4447Open in IMG/M
3300027763|Ga0209088_10319791All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii623Open in IMG/M
3300027764|Ga0209134_10135163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage850Open in IMG/M
3300027764|Ga0209134_10248698All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300027797|Ga0209107_10202429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage979Open in IMG/M
3300027798|Ga0209353_10056551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1799Open in IMG/M
3300027798|Ga0209353_10336107All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii633Open in IMG/M
3300027808|Ga0209354_10243942All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii722Open in IMG/M
3300027848|Ga0209390_10723878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage571Open in IMG/M
3300027892|Ga0209550_10684601All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii592Open in IMG/M
3300027900|Ga0209253_11011832All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium573Open in IMG/M
3300028298|Ga0268280_1202680All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage504Open in IMG/M
3300031746|Ga0315293_10773896All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage706Open in IMG/M
3300031772|Ga0315288_10682391All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii972Open in IMG/M
3300031787|Ga0315900_10426486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1035Open in IMG/M
3300031857|Ga0315909_10189617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1642Open in IMG/M
3300031857|Ga0315909_10723281All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage642Open in IMG/M
3300031885|Ga0315285_10668689All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage674Open in IMG/M
3300031997|Ga0315278_11771033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300032018|Ga0315272_10498305All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300032050|Ga0315906_10351892All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1303Open in IMG/M
3300032053|Ga0315284_12251112Not Available541Open in IMG/M
3300032462|Ga0335396_10849441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300032516|Ga0315273_10775016All Organisms → Viruses → Predicted Viral1252Open in IMG/M
3300033980|Ga0334981_0234329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage839Open in IMG/M
3300033994|Ga0334996_0316932All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage768Open in IMG/M
3300033994|Ga0334996_0320971All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage761Open in IMG/M
3300033996|Ga0334979_0431992All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300034013|Ga0334991_0258553All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300034050|Ga0335023_0427650All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage696Open in IMG/M
3300034120|Ga0335056_0396582All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300034122|Ga0335060_0491939All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii633Open in IMG/M
3300034167|Ga0335017_0366148All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage788Open in IMG/M
3300034272|Ga0335049_0005839All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9148Open in IMG/M
3300034283|Ga0335007_0577250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage656Open in IMG/M
3300034283|Ga0335007_0726608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300034284|Ga0335013_0550135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake28.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater13.38%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake11.97%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.34%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.63%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water4.93%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater3.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.82%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.82%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.82%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.11%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater2.11%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.11%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.41%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.41%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.70%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.70%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.70%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.70%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.70%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.70%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.70%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.70%
HypersalineEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline0.70%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001523Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micronEnvironmentalOpen in IMG/M
3300002202Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007520Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012714Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300020554Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022748Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MGEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027129Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8hEnvironmentalOpen in IMG/M
3300027152Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8dEnvironmentalOpen in IMG/M
3300027156Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027213Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027486Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027600Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027656Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027707Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027744Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027848Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300028298Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40mEnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034013Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI1221J15618_116477773300001523HypersalineVAIYESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT*
metazooDRAFT_125776323300002202LakeAFICVPSAIAIYESPVLRLSTNVVTSGEIETMIYGYLATKTLVSGGLRRFNMTA*
JGI25908J49247_1015875623300003277Freshwater LakePVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT*
Ga0007748_1001475523300004769Freshwater LakeVAIMESPVLQLSTNIITTGEIETMLYGYMAVKTLVAGGVRRFNLT*
Ga0049083_1032485423300005580Freshwater LenticIVPSSVVVYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT*
Ga0049082_1023132023300005584Freshwater LenticSVSIYESPILRLSVNQPASGEIETALYGYMAAGVLVAGGVRRFNLT*
Ga0075465_1010401813300006037AqueousLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA*
Ga0070744_1002807953300006484EstuarineIYESPVLRLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA*
Ga0070744_1014427013300006484EstuarineLRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNMTA*
Ga0070744_1021098823300006484EstuarinePILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT*
Ga0075464_1110159123300006805AqueousIVPSSMYIAESPVLRLSTNIPTSGEIETMLYGYIAAKTLVSGGIRRFNLT*
Ga0070748_132228223300006920AqueousLSTNVVTTGEIETMLYGYMAVKTVVAGGVRRFNLT*
Ga0075460_1012899633300007234AqueousMSTNVVANGQIETMLYGYLACGVLVAGGVRRFNLT*
Ga0105054_1098827613300007520FreshwaterIYESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT*
Ga0099851_118429023300007538AqueousSAFIVTPSAVAIYESPVLRMSTNVVTSGEIETMLYGYLACGVLVAGGVRRFNLT*
Ga0102828_106721913300007559EstuarineSPILRLSVNQPASGEIETALYGYMAAGVLVAGGVRRYNLT*
Ga0102859_115789423300007708EstuarineSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT*
Ga0105745_105813013300007972Estuary WaterVAIYESPVLQLSTNIVTTGEIETMLYGYMAVKTITAGGVRRFNLT*
Ga0105098_1027590023300009081Freshwater SedimentYESPILRMSTNHVASGEIETMLYGYLAVGVLTAGGVRRFNLT*
Ga0114968_1017451313300009155Freshwater LakeVLRLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA*
Ga0114977_1018744833300009158Freshwater LakeVAIMESPVLQLSTNVVSTGEIETMLYGYLAVKTLVAGGVRRFNLT*
Ga0114978_1024543933300009159Freshwater LakeLATNVVTSGEIEIMLYGYLATGVLVAGGVRRYNLT*
Ga0114978_1044414723300009159Freshwater LakePVLRLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA*
Ga0114978_1060375423300009159Freshwater LakeSAFIVVPSSVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS*
Ga0114981_1009151353300009160Freshwater LakeIVVPSSVAIYESPVLRMSTNVVTTGEIETSIYGYMAAGVLVAGGVRRFNLT*
Ga0114981_1014629843300009160Freshwater LakeAIYESPVLRLSTNTPTTGEIETALYGYMAAGVVVAGGVRRFNLT*
Ga0105102_1026381633300009165Freshwater SedimentMSTNVVTSGEIETMLYGYLAVGVLTAGGVRRFNLT*
Ga0114979_1009536413300009180Freshwater LakeRLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA*
Ga0114979_1059870113300009180Freshwater LakeLQLSTNVVSTGEIETMLYGYLAVKTLVAGGVRRFNLT*
Ga0114979_1072396113300009180Freshwater LakeRMQTNIASTGEIETMLYGYLAVGVLVSGGVRRFNLT*
Ga0114969_1076317623300009181Freshwater LakePVLQLSTNVVTTGEIETMLYGYMAVKTVVAGGVRRFNLT*
Ga0114974_1019840613300009183Freshwater LakePSSVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS*
Ga0114974_1028115423300009183Freshwater LakeVVPSSMYIAESPVLRLSTNIPTSGEIETMLYGYIAAKTLVSGGIRRFNLT*
Ga0136655_111890323300010316Freshwater To Marine Saline GradientSAVAIYESPILRMSTNVVTSGEIETMLYGYLAVGVLTAGGVRRFNLT*
Ga0129324_1038870413300010368Freshwater To Marine Saline GradientAFIVVPSSVAIYESPVLQLSTNVVTTGEIETMLYGYMAVKTITAGGVRRFNLT*
Ga0129324_1043161723300010368Freshwater To Marine Saline GradientVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLT*
Ga0153805_104874113300012013Surface IceVPSAVSIYESPILRLSTNIPTSGEIETSLYGYMAVGVLVSGGVRRFNLT*
Ga0157601_113577113300012714FreshwaterIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLT*
(restricted) Ga0172367_1059831213300013126FreshwaterIIYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT*
(restricted) Ga0172372_1050653313300013132FreshwaterIIYESPILRLSTNVVVSGEIETMIYGYLATKVLVAGGVRRFNLT*
(restricted) Ga0172362_1041584533300013133SedimentSPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT*
Ga0170791_1093262213300013295FreshwaterVSIYESPILRLSVNQPATGEIETALYGYMATGVLVAGGVRRFNLT*
Ga0170791_1225465423300013295FreshwaterVPSAVAIYESPVLQLSTNVVTTGEIETMLYGYMAVKTVVAGGVRRFNLT*
Ga0170791_1520189413300013295FreshwaterVPSSVAIYESPTLQLATNVVTSGEIEIMLYGYLATGVLVAGGVRRYNLT*
(restricted) Ga0172376_1059427013300014720FreshwaterLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT*
Ga0119960_104166513300014811AquaticVSQSRSICASPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS*
Ga0181364_100803653300017701Freshwater LakePSAVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKTLVAGGVRRFNLT
Ga0181350_105099413300017716Freshwater LakePSSVAIMESPVLQLSTNIITTGEIETMLYGYMAVKTLVAGGVRRFNLT
Ga0181350_109363523300017716Freshwater LakeRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT
Ga0181362_105352613300017723Freshwater LakePSSVSIYESPILRLSVNQPASGEIETALYGYMAAGVLVAGGVRRFNLT
Ga0181362_107570423300017723Freshwater LakeVVPSSVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT
Ga0181365_101687853300017736Freshwater LakeFIVVPSAVAIYESPVLQLSTNVPTSGEIETMLYGYLAVKTLVAGGVRRFNLT
Ga0181343_121920013300017766Freshwater LakeSPVLQLSTNVVTTGEIETMLYGYMAVKTIVAGGVRRFNLT
Ga0181357_116452623300017777Freshwater LakeVYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT
Ga0181357_120734113300017777Freshwater LakeSAFIVVPSSVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT
Ga0181357_122003113300017777Freshwater LakeRLSVNQPASGEIETALYGYMAAGVLVAGGVRRFNLT
Ga0181357_133449023300017777Freshwater LakeFIVVPSSVIIYESPILRLSTNVVTSGEIETMIYGYMATKVLVAGGVRRFNMT
Ga0181349_100864413300017778Freshwater LakeAFIVTPSAVAIYESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT
Ga0181349_123298513300017778Freshwater LakeIIVPSSVVVYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT
Ga0181346_124721013300017780Freshwater LakeSPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT
Ga0181348_117880613300017784Freshwater LakeSIYESPILRLSTNIPTTGEIETSLYGYMAVGVLVQGGVRRFNLT
Ga0181348_124461613300017784Freshwater LakePVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT
Ga0181355_127787013300017785Freshwater LakeIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT
Ga0181355_137343523300017785Freshwater LakeIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS
Ga0181359_107471733300019784Freshwater LakeASSVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT
Ga0181359_109039433300019784Freshwater LakeRIRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT
Ga0181359_113691833300019784Freshwater LakeRQLSTNVPTSGEIETMLYGYLAVKTLVAGGVRRFNLT
Ga0181359_126294423300019784Freshwater LakeLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT
Ga0194119_1009281913300020220Freshwater LakeILRLSTNVVVSGEIETMVYGYLATKVLVAGGVRRFNLT
Ga0208599_104546713300020554FreshwaterVVPSSVSIYESPILRLSTNIPTSGEIETSLYGYMAVGVLVQGGVRRFNLT
Ga0210301_105640613300021325EstuarineSSVAIYESPILRMSTNVVTTGEIETALYGYLAVGVLVAGGVRRFNMTA
Ga0222714_1049594423300021961Estuarine WaterLRLGTNVPTSGEIELMLYGYLATKTLVSGGLQRYNLT
Ga0222713_1001551413300021962Estuarine WaterLRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNMTA
Ga0222713_1026490913300021962Estuarine WaterIVVPSAVSIYESPTLRLSTNIPTSGEIETALYGYMAVGVLVAGGVRRFNLT
Ga0222713_1037040513300021962Estuarine WaterIYESPTLRLSTNIPTSGEIETSLYGYMAVGVLVAGGVRRFNLT
Ga0222712_1020850433300021963Estuarine WaterVLRLSTNVPTSGEIELMLYGYLATKTLVSTGLQRYNMTA
Ga0222712_1047692023300021963Estuarine WaterESPVLRLSTNVPVSGEIETMLYGYLATKTLVAGGLRRFNLT
Ga0222712_1060570613300021963Estuarine WaterILQLQTNVPTSGEIEIELFGFMAVKTLIATGLQRYNLT
Ga0181354_108824533300022190Freshwater LakeVSIYESPILRLSTNIPTSGEIETSLYGYMAVGVLVAGGVRRFNLT
Ga0181354_124943923300022190Freshwater LakeIIVYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT
Ga0181351_108807533300022407Freshwater LakeRRKENQPASGEIETALYGYMAAGVLVAGGVRRFNLT
Ga0181351_118866113300022407Freshwater LakeVVVYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT
Ga0228702_102815653300022748FreshwaterLRLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA
Ga0214917_1006822213300022752FreshwaterSPVLRLSTNVPTSGEIELMLYGYMATKTLVSGGLQRYNMTA
Ga0214919_10008040223300023184FreshwaterYESQILQLSTNTPTSGEIEVELFGFLATKTLIATGLQRYNLT
Ga0244775_1134071123300024346EstuarineSSVAIYESPTLQLATNVVTSGEIEIMLYGYLATGVLVAGGVRRYNLT
Ga0208161_109485613300025646AqueousESPILRLSTNIPTSGEIETSLYGYMAVGVLVAGGVRRFNLT
Ga0208019_112443123300025687AqueousIVVPSSVSIYESPILRLSTNIPTSGEIETSLYGYMAVGVLVAGGVRRFNLT
Ga0208542_115950023300025818AqueousMSTNVVANGQIETMLYGYLACGVLVAGGVRRFNLT
Ga0208916_1033520313300025896AqueousAIYESPVLRLSTNVPTSGEIETMLYGYLATKTLVAGGLRRFNLT
Ga0255067_102267633300027129FreshwaterSTNVPTSGEIELMLYGYLATKTLVSGGLQRFNMTA
Ga0255100_109772713300027152FreshwaterIYESPTLQLATNVVTSGEIEIMLYGYLATGVLVAGGVRRFNLT
Ga0255078_105163113300027156FreshwaterPSSVAIYESPTLQLATNVVTSGEIEIMLYGYLATGVLVAGGVRRYNLT
Ga0208555_100428213300027213EstuarineVLQLSTNIITTGEIETMLYGYMAVKTLVAGGVRRFNLT
Ga0255086_103192913300027486FreshwaterVLRLSTNVVTSGEIETMIYGYLATKTLVSGGLRRFNLT
Ga0255117_102289613300027600FreshwaterAFIVVPSAVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT
Ga0209357_111190413300027656Freshwater LakeLRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS
Ga0209769_108355933300027679Freshwater LakeESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT
Ga0209769_110594513300027679Freshwater LakeVPSSVSIYESPILRLSVNQPASGEIETALYGYMAAGVLVAGGVRRFNLT
Ga0209443_124098013300027707Freshwater LakeSPALQLSTNVPSTGEIETELFGFIAVKTLVSTGLQRYNMTA
Ga0209442_132100313300027732Freshwater LakeAFIIVPSSVVIYESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT
Ga0209190_117614113300027736Freshwater LakeAFIVVPSSVAIYESPVLRLSTNTPTTGEIETALYGYMATGVLVAGGVRRFNLT
Ga0209355_103379113300027744Freshwater LakePSSVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT
Ga0209596_133470623300027754Freshwater LakeAIAIYESPVLRLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA
Ga0209444_1032967223300027756Freshwater LakePILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT
Ga0209088_1001296213300027763Freshwater LakeRLSTNVPTSGEIELMLYGYLATKTLVSGGLQRYNMTA
Ga0209088_1031979123300027763Freshwater LakeLSTNVVSTGEIETMLYGYLAVKTLVAGGVRRFNLT
Ga0209134_1013516323300027764Freshwater LakeVLQLSTNIVTTGEIETMLYGYLAVKVVTAGGVRRFNLT
Ga0209134_1024869823300027764Freshwater LakeILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS
Ga0209107_1020242933300027797Freshwater And SedimentSSVAIYESPVLQLSTNVVTTGEIETMLYGYLATKVIVAGGVRRFNLT
Ga0209353_1005655113300027798Freshwater LakeESPILRLSTNVVTSGEIETMIYGYLATKVLVAGGVRRFNLT
Ga0209353_1033610723300027798Freshwater LakeIMESPVLQLSTNIITTGEIETMLYGYLAVKTLVAGGVRRYNLT
Ga0209354_1024394213300027808Freshwater LakeSAVAIMESPVLQLSTNIITTGEIETMLYGYLAVKTLVAGGVRRYNLT
Ga0209390_1072387813300027848FreshwaterYESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT
Ga0209550_1068460113300027892Freshwater LakeSVAIMESPVLQLSTNIITTGEIETMLYGYMAVKTLVAGGVRRFNLT
Ga0209253_1101183213300027900Freshwater Lake SedimentESPVLRLSTNTPTTGEIETALYGYMATGVLVAGGVRRFNLT
Ga0268280_120268013300028298Saline WaterSSVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS
Ga0315293_1077389613300031746SedimentPILRMSTNVVTSGEIETMLYGYLACGVLVAGGVRRFNLT
Ga0315288_1068239113300031772SedimentAVAIMESPVLQLSTNVVSTGEIETMLYGYLAVKTLVAGGVRRFNLT
Ga0315900_1042648613300031787FreshwaterRLSTNIPTSGEIETSLYGYMAVGVLVQGGVRRFNLT
Ga0315909_1018961713300031857FreshwaterPSSVAIYESPILRMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT
Ga0315909_1072328123300031857FreshwaterAFIVVPSSVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS
Ga0315285_1066868913300031885SedimentRLSTNIPTSGEIELMLYGYLATKTLVSGGLQRYNMT
Ga0315278_1177103313300031997SedimentAIAIYESPVLRLSTNIPTSGEIELMLYGYLATKTLVSGGLQRYNMTA
Ga0315272_1049830513300032018SedimentPVLRLSTNIPTSGEIELMLYGYLATKTLVSGGLQRYNMTA
Ga0315906_1035189213300032050FreshwaterPILRLSTNIPTSGEIETSLYGYMAVGVLVQGGVRRFNLT
Ga0315284_1225111223300032053SedimentIAIYESPVLKLSTNIPASGEISTMLYGYLATKTLVSGGLRRFNV
Ga0335396_1084944123300032462FreshwaterPLLRMSTNVVTSGEIETMLYGYMAVGVLVAGGVRRFNLT
Ga0315273_1077501613300032516SedimentVLRLGTNIPTSGEIELSLYGYLATKTLVSGGLQRYNMTA
Ga0334981_0234329_2_1393300033980FreshwaterVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLT
Ga0334996_0316932_1_1563300033994FreshwaterIVTPSSVAIYESPILRLSTNHVASGEIETMLYGYLAVGVLTAGGVRRFNLT
Ga0334996_0320971_2_1393300033994FreshwaterVAIYESPILRMSTNVVTTGEIETALYGYLAVGVLTAGGVRRFNLT
Ga0334979_0431992_3_1703300033996FreshwaterESAFIVTPSAVAIYESPILRMSTNVVTSGEIETALYGYLAVGVLTAGGVRRFNLS
Ga0334991_0258553_603_7103300034013FreshwaterMSTNVVTSGEIETMLYGYLAVGVLVAGGVRRFNLT
Ga0335023_0427650_3_1583300034050FreshwaterIVVPSSVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLT
Ga0335056_0396582_615_7433300034120FreshwaterYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT
Ga0335060_0491939_472_6333300034122FreshwaterAFIVVPSSVAIYESPVLQLSTNVVTTGEIETMLYGYMAVKTVVAGGVRRFNLT
Ga0335017_0366148_668_7873300034167FreshwaterPILRLSTNIPTSGEIETALYGYMAVGVLVQGGVRRFNLT
Ga0335049_0005839_3_1133300034272FreshwaterRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS
Ga0335007_0577250_519_6563300034283FreshwaterVAIYESPVLQLSTNVVTTGEIETMLYGYLAVKVVTAGGVRRFNLT
Ga0335007_0726608_1_1413300034283FreshwaterAVSIYESPILRLSTNIPTSGEIETSLYGYMAVGVLVQGGVRRFNLT
Ga0335013_0550135_2_1513300034284FreshwaterVPSSVSIYESPILRLSVNQPATGEIETALYGYMAVGVLVAGGVRRFNLS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.