Scaffold Ga0197853_1077317

Overview

Basic Information

• Taxon OID: 3300019775
• Scaffold ID: Ga0197853_1077317
• Source Dataset Name: Lab enriched sediment microbial communities from hydrocarbon-contaminated retail site, Toronto, Canada - S1, HI.1247_001
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Genome Quebec
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 935
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enriched Sediment → Metagenomes From Benzene-Degrading Nitrate-Reducing Cultures

Source Dataset Sampling Location

• Location Name: Toronto, ON, Canada
• Coordinates
  • Lat. (^o): 43.6532
  • Long. (^o): -79.3832

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005246	Metagenome / Metatranscriptome	407	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0197853_10773171	F005246	N/A	MKKEIVVEHFLAGRRVVIAKFVAHRFKEVQNKAKKVVGIVNLYEVQCADGKAPTVQVWYPRSVQSVEQAAKDCPCQFKDGQKIVVEFDLMEPNTFDAKNGVLIRAGSVLPLE