Scaffold Ga0193959_1212749

Overview

Basic Information

• Taxon OID: 3300019766
• Scaffold ID: Ga0193959_1212749
• Source Dataset Name: Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_2_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 525
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location

• Location Name: USA: Delaware
• Coordinates
  • Lat. (^o): 38.7906
  • Long. (^o): -75.1644
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000866	Metagenome / Metatranscriptome	855	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193959_12127491	F000866	N/A	AIFGRDMLFDVPYLADWNKVGDYRQRQTDRNTARENKGRVEWDYAVGDKVLVRKEGILRKSESKYEKEPWTVSQVHTNGTIRIQRGTKSERLNIRRVTPFFEEMEI