| Basic Information | |
|---|---|
| Taxon OID | 3300019209 Open in IMG/M |
| Scaffold ID | Ga0179951_1035112 Open in IMG/M |
| Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW3_MetaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 537 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Japan: Saitama Prefecture | |||||||
| Coordinates | Lat. (o) | 35.92 | Long. (o) | 139.63 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F091072 | Metagenome / Metatranscriptome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0179951_10351121 | F091072 | N/A | MKEAVAPVREEAEEEIRTLLDGAQAAWAQYKRGQGARITSARELDAFLDSF |
| ⦗Top⦘ |