Scaffold Ga0188835_1001068

Overview

Basic Information

• Taxon OID: 3300019096
• Scaffold ID: Ga0188835_1001068
• Source Dataset Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3557
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 62.09708
  • Long. (^o): 18.5427
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105042	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0188835_10010682	F105042	GGA	MPRGQLTKDEMKYQVLKLKQKLQSEQIGYTSDPKALANKYLNEVLDKIEEYRVQ