NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0188856_1000069

Scaffold Ga0188856_1000069


Overview

Basic Information
Taxon OID3300019076 Open in IMG/M
Scaffold IDGa0188856_1000069 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Baltic Sea - GS683_0p8
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1529
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)54.570232Long. (o)11.332183Alt. (m)Depth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000720Metagenome / Metatranscriptome923Y
F004988Metagenome / Metatranscriptome416Y
F090883Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0188856_10000694F000720GAGGMTLQDDKIMRHKIPNRMMSATFTLPIDDRKVVGIVNYIATEEGIIPMALWVKIKPTDSYIDRELRASGKLISRCLQHGEDLKELAETLSQDNIIGQMVHYFVKNIEEIITGVQPNKKQRMLSTDPYAAQMKE
Ga0188856_10000695F090883GAGGMVTIALKMKRINNCRDMLSKVTCPRMRLMWKRNYEKLLREYWEETGERILNAAGQVH
Ga0188856_10000696F004988N/ARCNGNGYIRIMPVVAGVFDKATETDCPMCEEIVTHMGQRITTHSGYVKLPIKDTRKNIEGGRESKTKWSGETLPEVGKGCP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.