Scaffold Ga0192831_103295

Overview

Basic Information

• Taxon OID: 3300019065
• Scaffold ID: Ga0192831_103295
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_047 - TARA_N000000278 (ERX1782424-ERR1711901)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 561
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_047
• Coordinates
  • Lat. (^o): -2.0465
  • Long. (^o): 72.1568
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019482	Metagenome / Metatranscriptome	229	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0192831_1032951	F019482	AGG	MYRAGSKLTNMMAFLKPSSCSFLAHSSDINDLLEGLDGVLEDWLDGLHDTESSLHIVDLWLHALDGLHLSGDLNEWLSIIKSLKDSSGKSLLDVLDGSSLGNGGVTISSGLGSLGRVEGGLEVDEELVFGHGVVLGGGNG