Scaffold Ga0193542_10030025

Overview

Basic Information

• Taxon OID: 3300018938
• Scaffold ID: Ga0193542_10030025
• Source Dataset Name: Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_039 - TARA_B100000091 (ERX1399742-ERR1328124)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 568
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Bathycoccus → Bathycoccus prasinos (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_039
• Coordinates
  • Lat. (^o): 18.5839
  • Long. (^o): 66.4727
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102591	Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193542_100300251	F102591	N/A	PLLAAYNGFYGVTLYHNWVTYYGPKGIMPYFLKTEGPVALMAWRMLGCLLLGITYGLLTAGPKDKTALKIATVGQAMMLPLMAMAGFGTDAATYAQTMWKTQLVVHAAMTYVGYSASQPTKTRSSSRRR