NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193611_1029750

Scaffold Ga0193611_1029750


Overview

Basic Information
Taxon OID3300018917 Open in IMG/M
Scaffold IDGa0193611_1029750 Open in IMG/M
Source Dataset NameSoil crust microbial communities from Colorado Plateau, Utah, USA - early-mid stage, 0 min after wetting v1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterQB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1749
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events

Source Dataset Sampling Location
Location NameUSA: Utah, Colorado Plateau, Green Butte Site
CoordinatesLat. (o)38.712053Long. (o)-109.695097Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072038Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0193611_10297503F072038GGAGGMDDETMQLLKAMREQLGKTSASRTVDALAAANTLGLEGRSLDFDRRLQDLVVAEYLEEPANPALMAQGKYL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.