Scaffold Ga0193547_10017469

Overview

Basic Information

• Taxon OID: 3300018895
• Scaffold ID: Ga0193547_10017469
• Source Dataset Name: Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_011 - TARA_X100000009 (ERX1408504-ERR1336912)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 750
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean: TARA_011
• Coordinates
  • Lat. (^o): 41.6686
  • Long. (^o): 2.7996
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097478	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193547_100174692	F097478	N/A	MNITKGWEMIHKISQMCDKVSVIYNKSMELRRLKYDTPKESRDENQINFLVQDIQALCREIANDTTTYTKT