Scaffold Ga0193253_1038665

Overview

Basic Information

• Taxon OID: 3300018846
• Scaffold ID: Ga0193253_1038665
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1172
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Pacific Ocean: TARA_092
• Coordinates
  • Lat. (^o): -33.6895
  • Long. (^o): -71.998
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028311	Metagenome / Metatranscriptome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193253_10386652	F028311	N/A	KETNKMAVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK