Basic Information | |
---|---|
Family ID | F028311 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 192 |
Average Sequence Length | 43 residues |
Representative Sequence | MPAAKKSEKRIKKEAYWRRLQETARKYKNALFVDANNVSSK |
Number of Associated Samples | 140 |
Number of Associated Scaffolds | 192 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Eukaryota |
% of genes with valid RBS motifs | 4.69 % |
% of genes near scaffold ends (potentially truncated) | 84.38 % |
% of genes from short scaffolds (< 2000 bps) | 100.00 % |
Associated GOLD sequencing projects | 134 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Eukaryota (86.458 % of family members) |
NCBI Taxonomy ID | 2759 |
Taxonomy | All Organisms → cellular organisms → Eukaryota |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (42.188 % of family members) |
Environment Ontology (ENVO) | Unclassified (68.750 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (71.354 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 192 Family Scaffolds |
---|---|---|
PF00466 | Ribosomal_L10 | 52.60 |
PF00428 | Ribosomal_60s | 7.29 |
PF01551 | Peptidase_M23 | 0.52 |
PF00160 | Pro_isomerase | 0.52 |
COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
---|---|---|---|
COG0244 | Ribosomal protein L10 | Translation, ribosomal structure and biogenesis [J] | 52.60 |
COG2058 | Ribosomal protein L12E/L44/L45/RPP1/RPP2 | Translation, ribosomal structure and biogenesis [J] | 7.29 |
COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.98 % |
Unclassified | root | N/A | 13.02 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000368|DelMOSpr2010DRAFT_102454 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1047 | Open in IMG/M |
3300003714|Ga0008272_104944 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 933 | Open in IMG/M |
3300006165|Ga0075443_10317483 | Not Available | 574 | Open in IMG/M |
3300006357|Ga0075502_1624829 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1149 | Open in IMG/M |
3300006382|Ga0075494_1001436 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1134 | Open in IMG/M |
3300006383|Ga0075504_1329375 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1129 | Open in IMG/M |
3300006392|Ga0075507_1414475 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1055 | Open in IMG/M |
3300006399|Ga0075495_1510467 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1118 | Open in IMG/M |
3300006400|Ga0075503_1651174 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1151 | Open in IMG/M |
3300006401|Ga0075506_1744056 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1147 | Open in IMG/M |
3300006571|Ga0075505_1326375 | Not Available | 770 | Open in IMG/M |
3300008934|Ga0103737_1002043 | All Organisms → cellular organisms → Eukaryota | 1820 | Open in IMG/M |
3300008952|Ga0115651_1164796 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1536 | Open in IMG/M |
3300008993|Ga0104258_1079634 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 612 | Open in IMG/M |
3300009432|Ga0115005_10225660 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1464 | Open in IMG/M |
3300009543|Ga0115099_10002799 | Not Available | 559 | Open in IMG/M |
3300009543|Ga0115099_10634235 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1087 | Open in IMG/M |
3300009599|Ga0115103_1287215 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1147 | Open in IMG/M |
3300009599|Ga0115103_1343384 | Not Available | 972 | Open in IMG/M |
3300009599|Ga0115103_1404303 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 981 | Open in IMG/M |
3300009599|Ga0115103_1653762 | All Organisms → cellular organisms → Eukaryota | 1004 | Open in IMG/M |
3300009606|Ga0115102_10889388 | Not Available | 615 | Open in IMG/M |
3300009608|Ga0115100_10228027 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1123 | Open in IMG/M |
3300009677|Ga0115104_10052294 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1146 | Open in IMG/M |
3300009677|Ga0115104_10162704 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 906 | Open in IMG/M |
3300009677|Ga0115104_10196061 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1082 | Open in IMG/M |
3300009677|Ga0115104_10730829 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 656 | Open in IMG/M |
3300009679|Ga0115105_10473704 | Not Available | 1084 | Open in IMG/M |
3300010981|Ga0138316_10532858 | Not Available | 1080 | Open in IMG/M |
3300012408|Ga0138265_1105167 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1173 | Open in IMG/M |
3300012408|Ga0138265_1283581 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 558 | Open in IMG/M |
3300012412|Ga0138266_1015963 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 672 | Open in IMG/M |
3300012414|Ga0138264_1241952 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1178 | Open in IMG/M |
3300012415|Ga0138263_1443267 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 990 | Open in IMG/M |
3300012416|Ga0138259_1456813 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 580 | Open in IMG/M |
3300012416|Ga0138259_1609814 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 514 | Open in IMG/M |
3300012418|Ga0138261_1286382 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 576 | Open in IMG/M |
3300012418|Ga0138261_1796751 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1158 | Open in IMG/M |
3300012472|Ga0129328_1117281 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 947 | Open in IMG/M |
3300012767|Ga0138267_1162875 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1171 | Open in IMG/M |
3300012782|Ga0138268_1114045 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1178 | Open in IMG/M |
3300012782|Ga0138268_1121750 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 707 | Open in IMG/M |
3300016703|Ga0182088_1019041 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1147 | Open in IMG/M |
3300016703|Ga0182088_1320721 | Not Available | 985 | Open in IMG/M |
3300016723|Ga0182085_1222895 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1141 | Open in IMG/M |
3300016740|Ga0182096_1132402 | Not Available | 1149 | Open in IMG/M |
3300016746|Ga0182055_1210384 | Not Available | 667 | Open in IMG/M |
3300016766|Ga0182091_1139475 | Not Available | 1158 | Open in IMG/M |
3300016781|Ga0182063_1666131 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1107 | Open in IMG/M |
3300018515|Ga0192960_101180 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1153 | Open in IMG/M |
3300018628|Ga0193355_1002547 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1319 | Open in IMG/M |
3300018684|Ga0192983_1008282 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1207 | Open in IMG/M |
3300018692|Ga0192944_1009526 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1223 | Open in IMG/M |
3300018692|Ga0192944_1012544 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1118 | Open in IMG/M |
3300018730|Ga0192967_1011013 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1304 | Open in IMG/M |
3300018739|Ga0192974_1049520 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 717 | Open in IMG/M |
3300018823|Ga0193053_1013634 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1234 | Open in IMG/M |
3300018825|Ga0193048_1058446 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 584 | Open in IMG/M |
3300018831|Ga0192949_1028167 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1141 | Open in IMG/M |
3300018846|Ga0193253_1030865 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1292 | Open in IMG/M |
3300018846|Ga0193253_1038665 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1172 | Open in IMG/M |
3300018871|Ga0192978_1024284 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1121 | Open in IMG/M |
3300018871|Ga0192978_1025823 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1090 | Open in IMG/M |
3300018926|Ga0192989_10036773 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1237 | Open in IMG/M |
3300018926|Ga0192989_10047631 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1096 | Open in IMG/M |
3300018975|Ga0193006_10094997 | All Organisms → cellular organisms → Eukaryota | 893 | Open in IMG/M |
3300018980|Ga0192961_10041371 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1292 | Open in IMG/M |
3300018980|Ga0192961_10047540 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1223 | Open in IMG/M |
3300018989|Ga0193030_10029199 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1290 | Open in IMG/M |
3300019031|Ga0193516_10069019 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1193 | Open in IMG/M |
3300019032|Ga0192869_10088416 | Not Available | 1166 | Open in IMG/M |
3300019036|Ga0192945_10044798 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1244 | Open in IMG/M |
3300019048|Ga0192981_10082676 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1233 | Open in IMG/M |
3300019116|Ga0193243_1007450 | Not Available | 1215 | Open in IMG/M |
3300019123|Ga0192980_1020110 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1239 | Open in IMG/M |
3300019149|Ga0188870_10035671 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1174 | Open in IMG/M |
3300019153|Ga0192975_10070568 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1241 | Open in IMG/M |
3300019153|Ga0192975_10088749 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1117 | Open in IMG/M |
3300019261|Ga0182097_1111553 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1126 | Open in IMG/M |
3300019261|Ga0182097_1318822 | Not Available | 1150 | Open in IMG/M |
3300019272|Ga0182059_1752882 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1087 | Open in IMG/M |
3300021169|Ga0206687_1720186 | Not Available | 1143 | Open in IMG/M |
3300021342|Ga0206691_1715185 | All Organisms → cellular organisms → Eukaryota | 1217 | Open in IMG/M |
3300021348|Ga0206695_1018040 | Not Available | 574 | Open in IMG/M |
3300021353|Ga0206693_1798138 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1235 | Open in IMG/M |
3300021359|Ga0206689_11039750 | Not Available | 813 | Open in IMG/M |
3300021359|Ga0206689_11114145 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 829 | Open in IMG/M |
3300021365|Ga0206123_10330193 | Not Available | 642 | Open in IMG/M |
3300021872|Ga0063132_105731 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1135 | Open in IMG/M |
3300021872|Ga0063132_130734 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 510 | Open in IMG/M |
3300021874|Ga0063147_113509 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 580 | Open in IMG/M |
3300021875|Ga0063146_121203 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1113 | Open in IMG/M |
3300021879|Ga0063113_109555 | All Organisms → cellular organisms → Eukaryota | 837 | Open in IMG/M |
3300021887|Ga0063105_1006945 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1173 | Open in IMG/M |
3300021887|Ga0063105_1014909 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1116 | Open in IMG/M |
3300021887|Ga0063105_1015721 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1046 | Open in IMG/M |
3300021887|Ga0063105_1072871 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 571 | Open in IMG/M |
3300021889|Ga0063089_1031830 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1128 | Open in IMG/M |
3300021890|Ga0063090_1031218 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1125 | Open in IMG/M |
3300021896|Ga0063136_1109759 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 990 | Open in IMG/M |
3300021898|Ga0063097_1043029 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 875 | Open in IMG/M |
3300021899|Ga0063144_1007540 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1127 | Open in IMG/M |
3300021902|Ga0063086_1013962 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1155 | Open in IMG/M |
3300021905|Ga0063088_1009123 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 625 | Open in IMG/M |
3300021905|Ga0063088_1029403 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1082 | Open in IMG/M |
3300021906|Ga0063087_1003671 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1153 | Open in IMG/M |
3300021910|Ga0063100_1039860 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1146 | Open in IMG/M |
3300021910|Ga0063100_1056457 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 966 | Open in IMG/M |
3300021911|Ga0063106_1032635 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 854 | Open in IMG/M |
3300021911|Ga0063106_1044754 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1131 | Open in IMG/M |
3300021913|Ga0063104_1035413 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1114 | Open in IMG/M |
3300021921|Ga0063870_1003361 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1151 | Open in IMG/M |
3300021927|Ga0063103_1068856 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1137 | Open in IMG/M |
3300021934|Ga0063139_1058342 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1011 | Open in IMG/M |
3300021937|Ga0063754_1003697 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1150 | Open in IMG/M |
3300021941|Ga0063102_1001813 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 857 | Open in IMG/M |
3300021941|Ga0063102_1012424 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1158 | Open in IMG/M |
3300021941|Ga0063102_1014691 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1153 | Open in IMG/M |
3300021950|Ga0063101_1025948 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1154 | Open in IMG/M |
3300021950|Ga0063101_1146021 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 511 | Open in IMG/M |
3300021962|Ga0222713_10298937 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1026 | Open in IMG/M |
3300025890|Ga0209631_10223916 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 953 | Open in IMG/M |
3300025890|Ga0209631_10258047 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 865 | Open in IMG/M |
3300026448|Ga0247594_1016178 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1194 | Open in IMG/M |
3300026449|Ga0247593_1025221 | Not Available | 1139 | Open in IMG/M |
3300026465|Ga0247588_1021404 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1219 | Open in IMG/M |
3300026500|Ga0247592_1058321 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300026500|Ga0247592_1136025 | Not Available | 587 | Open in IMG/M |
3300026513|Ga0247590_1056430 | All Organisms → cellular organisms → Eukaryota | 1010 | Open in IMG/M |
3300027833|Ga0209092_10438463 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 677 | Open in IMG/M |
3300027849|Ga0209712_10126863 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1464 | Open in IMG/M |
3300028109|Ga0247582_1045241 | Not Available | 1144 | Open in IMG/M |
3300028110|Ga0247584_1041625 | Not Available | 1151 | Open in IMG/M |
3300028137|Ga0256412_1099106 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1058 | Open in IMG/M |
3300028137|Ga0256412_1393900 | Not Available | 508 | Open in IMG/M |
3300028282|Ga0256413_1075339 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1205 | Open in IMG/M |
3300028575|Ga0304731_10115635 | Not Available | 1080 | Open in IMG/M |
3300030653|Ga0307402_10200607 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1108 | Open in IMG/M |
3300030671|Ga0307403_10165454 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1136 | Open in IMG/M |
3300030671|Ga0307403_10703737 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 549 | Open in IMG/M |
3300030702|Ga0307399_10091616 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1262 | Open in IMG/M |
3300030709|Ga0307400_10822127 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 573 | Open in IMG/M |
3300030723|Ga0308129_1007572 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1136 | Open in IMG/M |
3300030725|Ga0308128_1009751 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1109 | Open in IMG/M |
3300030857|Ga0073981_10974664 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 692 | Open in IMG/M |
3300031540|Ga0308143_106733 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1155 | Open in IMG/M |
3300031570|Ga0308144_1011052 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1150 | Open in IMG/M |
3300031580|Ga0308132_1029914 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1137 | Open in IMG/M |
3300031580|Ga0308132_1052012 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 852 | Open in IMG/M |
3300031622|Ga0302126_10078424 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1322 | Open in IMG/M |
3300031674|Ga0307393_1026116 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1125 | Open in IMG/M |
3300031674|Ga0307393_1029372 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1073 | Open in IMG/M |
3300031674|Ga0307393_1034100 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1009 | Open in IMG/M |
3300031709|Ga0307385_10099296 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1073 | Open in IMG/M |
3300031710|Ga0307386_10136642 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1125 | Open in IMG/M |
3300031710|Ga0307386_10139181 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1117 | Open in IMG/M |
3300031710|Ga0307386_10272171 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 842 | Open in IMG/M |
3300031710|Ga0307386_10662720 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 556 | Open in IMG/M |
3300031717|Ga0307396_10245300 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 853 | Open in IMG/M |
3300031725|Ga0307381_10063266 | Not Available | 1152 | Open in IMG/M |
3300031725|Ga0307381_10068531 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1116 | Open in IMG/M |
3300031725|Ga0307381_10084011 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1025 | Open in IMG/M |
3300031725|Ga0307381_10203500 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 693 | Open in IMG/M |
3300031729|Ga0307391_10184158 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1086 | Open in IMG/M |
3300031729|Ga0307391_10833432 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 530 | Open in IMG/M |
3300031734|Ga0307397_10180863 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 925 | Open in IMG/M |
3300031735|Ga0307394_10087811 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1160 | Open in IMG/M |
3300031735|Ga0307394_10119165 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1009 | Open in IMG/M |
3300031738|Ga0307384_10122261 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1088 | Open in IMG/M |
3300031738|Ga0307384_10131974 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1055 | Open in IMG/M |
3300031738|Ga0307384_10168498 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 951 | Open in IMG/M |
3300031739|Ga0307383_10125727 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1159 | Open in IMG/M |
3300031739|Ga0307383_10125820 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | 1159 | Open in IMG/M |
3300031739|Ga0307383_10131454 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | 1137 | Open in IMG/M |
3300031739|Ga0307383_10142291 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1099 | Open in IMG/M |
3300031742|Ga0307395_10404393 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 594 | Open in IMG/M |
3300031743|Ga0307382_10109562 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1171 | Open in IMG/M |
3300031743|Ga0307382_10165358 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 970 | Open in IMG/M |
3300031752|Ga0307404_10095648 | All Organisms → cellular organisms → Eukaryota | 1163 | Open in IMG/M |
3300032491|Ga0314675_10123004 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1203 | Open in IMG/M |
3300032492|Ga0314679_10095247 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1279 | Open in IMG/M |
3300032517|Ga0314688_10136148 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1182 | Open in IMG/M |
3300032517|Ga0314688_10159440 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1114 | Open in IMG/M |
3300032519|Ga0314676_10172977 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1191 | Open in IMG/M |
3300032650|Ga0314673_10123879 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1160 | Open in IMG/M |
3300032651|Ga0314685_10211102 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1052 | Open in IMG/M |
3300032708|Ga0314669_10113137 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1262 | Open in IMG/M |
3300032709|Ga0314672_1069188 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1222 | Open in IMG/M |
3300032725|Ga0314702_1387257 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 524 | Open in IMG/M |
3300032730|Ga0314699_10114219 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1114 | Open in IMG/M |
3300032755|Ga0314709_10211288 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae | 1166 | Open in IMG/M |
3300033572|Ga0307390_10201152 | All Organisms → cellular organisms → Eukaryota | 1144 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 42.19% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 21.88% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 6.25% |
Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 6.25% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.73% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.21% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.69% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.12% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.04% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.52% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.52% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.52% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.52% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.52% |
Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.52% |
Ice Edge, Mcmurdo Sound, Antarctica | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica | 0.52% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000368 | Marine microbial communities from Delaware Coast, sample from Delaware MO Late spring/early summer | Environmental | Open in IMG/M |
3300003714 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006382 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006383 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006392 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006399 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006571 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300008934 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2C | Environmental | Open in IMG/M |
3300008952 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um | Environmental | Open in IMG/M |
3300008993 | Marine microbial communities from eastern North Pacific Ocean - P1 free-living | Environmental | Open in IMG/M |
3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010981 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4) | Environmental | Open in IMG/M |
3300012408 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012412 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012414 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012415 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012416 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012418 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012472 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012767 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012782 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016703 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016723 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016740 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016746 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016766 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016781 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300018515 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231) | Environmental | Open in IMG/M |
3300018628 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885) | Environmental | Open in IMG/M |
3300018684 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160) | Environmental | Open in IMG/M |
3300018692 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153) | Environmental | Open in IMG/M |
3300018730 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028) | Environmental | Open in IMG/M |
3300018739 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246) | Environmental | Open in IMG/M |
3300018823 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243) | Environmental | Open in IMG/M |
3300018825 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127) | Environmental | Open in IMG/M |
3300018831 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149) | Environmental | Open in IMG/M |
3300018846 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503) | Environmental | Open in IMG/M |
3300018871 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345) | Environmental | Open in IMG/M |
3300018926 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276) | Environmental | Open in IMG/M |
3300018975 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881) | Environmental | Open in IMG/M |
3300018980 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127) | Environmental | Open in IMG/M |
3300018989 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934) | Environmental | Open in IMG/M |
3300019031 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939) | Environmental | Open in IMG/M |
3300019032 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216) | Environmental | Open in IMG/M |
3300019036 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086) | Environmental | Open in IMG/M |
3300019048 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166) | Environmental | Open in IMG/M |
3300019116 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967) | Environmental | Open in IMG/M |
3300019123 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195) | Environmental | Open in IMG/M |
3300019149 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dT | Environmental | Open in IMG/M |
3300019153 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469) | Environmental | Open in IMG/M |
3300019261 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019272 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021342 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021348 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021353 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021359 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
3300021872 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021874 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021875 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S30 C1 B23 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021879 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-5 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021887 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021889 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021890 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021896 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021898 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021899 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021902 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021905 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021906 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021910 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021911 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021913 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021921 | Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021927 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021934 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021937 | Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Euk ARK-20-2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021941 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021950 | Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
3300026448 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026449 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026465 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026513 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028109 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028110 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028137 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028575 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030653 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030671 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030702 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030709 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030723 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030725 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030857 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031540 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031570 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031580 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
3300031674 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031709 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031710 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031717 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031725 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031729 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031734 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031735 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031738 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031739 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031742 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031743 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031752 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032491 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032492 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032517 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032519 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032650 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032651 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032708 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032709 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032725 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032730 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032755 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300033572 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSpr2010DRAFT_1024541 | 3300000368 | Marine | AEKKSEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK* |
Ga0008272_1049441 | 3300003714 | Marine | AVKKKSEKRIKKEAYWTRLQVVAQKYNNVLFVDADNVSSKQIAKDQS* |
Ga0075443_103174832 | 3300006165 | Marine | MAVKKKSAQRIKKEAYWFRLIDVAGKYKNALFVDSDNVSSK* |
Ga0075502_16248291 | 3300006357 | Aqueous | SIMPGVKKSEKRIKKEAYWKRLQVTARTYKNCLFVDANNVSSK* |
Ga0075494_10014361 | 3300006382 | Aqueous | MPAEKKSEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK* |
Ga0075504_13293751 | 3300006383 | Aqueous | PGVKKSEKRIKKEAYWKRLQVTARTYKNCLFVDANNVSSK* |
Ga0075507_14144753 | 3300006392 | Aqueous | LHSIMPGVKKSEKRIKKEAYWKRLQVTARTYKNCLFVDANNVSSK* |
Ga0075495_15104671 | 3300006399 | Aqueous | QMPAVKKSEKRLKKEAYWKRLQETARKYKNALFVDANNVSSK* |
Ga0075503_16511743 | 3300006400 | Aqueous | HSIMPGVKKSEKRIKKEAYWKRLQVTARTYKNCLFVDANNVSSK* |
Ga0075506_17440563 | 3300006401 | Aqueous | IMPGVKKSEKRIKKEAYWKRLQVTARTYKNCLFVDANNVSSK* |
Ga0075505_13263753 | 3300006571 | Aqueous | GVKKSEKRIKKEAYWKRLQVTARTYKNCLFVDANNVSSK* |
Ga0103737_10020431 | 3300008934 | Ice Edge, Mcmurdo Sound, Antarctica | AQRIKKEAYWFRLIDVAGKYKNALFVDSDNVSSK* |
Ga0115651_11647962 | 3300008952 | Marine | MAVKKKSEKRIKKENYWKRLQDVAHKYNNVLFINADNVSSL* |
Ga0104258_10796342 | 3300008993 | Ocean Water | LIYYLSFKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK* |
Ga0115005_102256602 | 3300009432 | Marine | MPAAVKKSDKRIKKEAYWGRLQETARKYKNALFVDANNVSSK* |
Ga0115099_100027991 | 3300009543 | Marine | MPVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK* |
Ga0115099_106342351 | 3300009543 | Marine | LSFKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK* |
Ga0115103_12872151 | 3300009599 | Marine | NKMPAVKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK* |
Ga0115103_13433841 | 3300009599 | Marine | QMPVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK* |
Ga0115103_14043031 | 3300009599 | Marine | MPAVKKTAKRIKKENYWRRIQQVAYKYNNVLFVNADNVSSK* |
Ga0115103_16537621 | 3300009599 | Marine | YYLSFKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK* |
Ga0115102_108893881 | 3300009606 | Marine | PVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK* |
Ga0115100_102280271 | 3300009608 | Marine | KMPAVKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK* |
Ga0115104_100522942 | 3300009677 | Marine | PVAKKSEKRIKKEAYWERLQITARKYKNALFVNANNVSSK* |
Ga0115104_101627042 | 3300009677 | Marine | MPAVKKTAKRIKKENYWRRIQQVAFKYNNVLFVNADNVSSL* |
Ga0115104_101960613 | 3300009677 | Marine | MSAVNKSEKRLKKESRWRRVQEIAYKYNNVLFVDANNVSSN* |
Ga0115104_107308291 | 3300009677 | Marine | KKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK* |
Ga0115105_104737044 | 3300009679 | Marine | VKKKSDKRVKKEAYWFRLQEVAQKYRNVLFVNADNVSSL* |
Ga0138316_105328583 | 3300010981 | Marine | KVRMAVKKKSEKRIKKEAYWTRLQQVAQKYRNVLFVNADNVSSL* |
Ga0138265_11051672 | 3300012408 | Polar Marine | PAAKKSEKRIKKEAYWRRLQETARKYKNALFVDANNVSSK* |
Ga0138265_12835811 | 3300012408 | Polar Marine | SEKRIKKEAYWVRLQDVAAKYNNIMFVDANNVSSK* |
Ga0138266_10159631 | 3300012412 | Polar Marine | KMAIKKKSEKRIKKEAYWVRLQDVAAKYNNIMFVDANNVSSK* |
Ga0138264_12419522 | 3300012414 | Polar Marine | KETNKMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK* |
Ga0138263_14432672 | 3300012415 | Polar Marine | YQLKMPKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK* |
Ga0138259_14568132 | 3300012416 | Polar Marine | AVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK* |
Ga0138259_16098141 | 3300012416 | Polar Marine | KMAVKKKSERRIKKENYWKRLQVVAHKYQNVLFVDGDNVSSQQI* |
Ga0138261_12863821 | 3300012418 | Polar Marine | PKIVKSDKRIKKEKYWGRLQHIVANYKNAAFIDANNVSSK* |
Ga0138261_17967511 | 3300012418 | Polar Marine | AAKKSEKRVKKEAYWRRLQETARKYKNALFVDANNVSSK* |
Ga0129328_11172812 | 3300012472 | Aqueous | EKRIKKEAYWRRLQETARKYNNALFVDANNVSSK* |
Ga0138267_11628751 | 3300012767 | Polar Marine | NKMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK* |
Ga0138268_11140451 | 3300012782 | Polar Marine | IKETNKMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK* |
Ga0138268_11217501 | 3300012782 | Polar Marine | IKMAVKKKSAQRIKKEAYWFRLIDVAGKYKNALFVDSDNVSSK* |
Ga0182088_10190411 | 3300016703 | Salt Marsh | IMLGVKKSEKRIKKEAYWKRLQVTTRTYKNCLFVDANNVSSK |
Ga0182088_13207213 | 3300016703 | Salt Marsh | MPQPIKKSEKRIKKEAYWKRLQVTARKYRNCLFVDANNVSS |
Ga0182085_12228951 | 3300016723 | Salt Marsh | IMPGVKKSEKRIKKEAYWKRLQVTTRTYKNCLFVDANNVSSK |
Ga0182096_11324021 | 3300016740 | Salt Marsh | ITQMPQPIKKSEKRIKKEAYWKRLQVTARKYRNCLFVDANNVSS |
Ga0182055_12103843 | 3300016746 | Salt Marsh | KKSEKRIKKEAYWKRLQVTARKYKNCLFVDANNVSSK |
Ga0182091_11394751 | 3300016766 | Salt Marsh | LITQMPQPIKKSEKRIKKEAYWKRLQVTARKYRNCLFVDANNVSS |
Ga0182063_16661311 | 3300016781 | Salt Marsh | MPVAKKSEKRIKKEAYWKRLQVTARKYKNCLFVDANNVSSK |
Ga0192960_1011802 | 3300018515 | Marine | SEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK |
Ga0193355_10025471 | 3300018628 | Marine | MPAAKKSEKRLKKETLWRKLQTLAFKYKNALFVDADNVSSKQISMLR |
Ga0192983_10082821 | 3300018684 | Marine | MGIEYIKETNKMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK |
Ga0192944_10095262 | 3300018692 | Marine | MGIIEYIKETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0192944_10125441 | 3300018692 | Marine | MGIIEYIKETNKMVVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0192967_10110131 | 3300018730 | Marine | MAVKKKSAQRIKKEAYWFRLIDVAGKYKNALFVDSDNVSSK |
Ga0192974_10495202 | 3300018739 | Marine | MPAAKKSEKRIKKEAYWRRLQETARKYKNALFVDANNVSSK |
Ga0193053_10136341 | 3300018823 | Marine | MAVKKKSAARIKKEAYWHRLIDVAGKYKNALFVDSDNVSSK |
Ga0193048_10584462 | 3300018825 | Marine | SDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0192949_10281671 | 3300018831 | Marine | ETNKMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK |
Ga0193253_10308652 | 3300018846 | Marine | YYLSFKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK |
Ga0193253_10386652 | 3300018846 | Marine | KETNKMAVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0192978_10242841 | 3300018871 | Marine | KMVVKKKSEKRVKKENYWDRIQEVAVKYKNVLFINSDNVSSLQICKLR |
Ga0192978_10258231 | 3300018871 | Marine | LKMPKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK |
Ga0192989_100367731 | 3300018926 | Marine | LSFKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK |
Ga0192989_100476312 | 3300018926 | Marine | KAKMGVKKSQKRINKEAFWTRLQMVSRKYRQVMFVDANQVSSLQIAKIR |
Ga0193006_100949971 | 3300018975 | Marine | MAVKKKSEKRIKKENYWKRLQDVARKYTNVLFINADNVSSL |
Ga0192961_100413712 | 3300018980 | Marine | MAVKKKSAQRIKKEAYWLRLIEVAGKYKNALFVDSDNVSSK |
Ga0192961_100475402 | 3300018980 | Marine | MGIIEYIKETNKMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK |
Ga0193030_100291994 | 3300018989 | Marine | MAVKKKSEKRIKKENYWRRLQDVARKYTNVLFINADNVSSL |
Ga0193516_100690193 | 3300019031 | Marine | MAVKKKSEKRIKKEAYWKRLQDVAQKYRNVLFVNADNVSSL |
Ga0192869_100884164 | 3300019032 | Marine | MAVKKKSEKRIKKEAYWVRLQQVAQKYRNVLFVNADNVSSL |
Ga0192945_100447982 | 3300019036 | Marine | EYMGIIEYIKETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0192981_100826762 | 3300019048 | Marine | YMGIIIFNSYQLKMPKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK |
Ga0193243_10074504 | 3300019116 | Marine | HKNMPAVKKSEKRLKKEALWRKLQTYAFKYKNALFVDANNVSSK |
Ga0192980_10201102 | 3300019123 | Marine | MGIIIFNSYQLKMPKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK |
Ga0188870_100356711 | 3300019149 | Freshwater Lake | KMPVAKKSDKRIKKENYWRRLQETARKYKNALFVDANNVSSK |
Ga0192975_100705682 | 3300019153 | Marine | KMAVKKKSAQRIKKEAYWFRLIDVAGKYKNALFVDSDNVSSK |
Ga0192975_100887491 | 3300019153 | Marine | KSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK |
Ga0182097_11115531 | 3300019261 | Salt Marsh | GVKKSEKRIKKEAYWKRLQVTTRTYKNCLFVDANNVSSK |
Ga0182097_13188221 | 3300019261 | Salt Marsh | QMPQPIKKSEKRIKKEAYWKRLQVTTRKYRNCLFIDANNVSS |
Ga0182059_17528821 | 3300019272 | Salt Marsh | KSEKRIKKEAYWKRLQVTARKYKNCLFVDANNVSSK |
Ga0206687_17201861 | 3300021169 | Seawater | QMPVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK |
Ga0206691_17151851 | 3300021342 | Seawater | LSFLRMAVQKKSAKRVKKENYWRRLQVTAGKYKNALFIDANNVSSNQIGKIR |
Ga0206695_10180401 | 3300021348 | Seawater | LKKMPKIVKSEKRIKKEKYWARLQKTAETYKYAAFIDANNVSSKQICMIR |
Ga0206693_17981382 | 3300021353 | Seawater | SFKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK |
Ga0206689_110397501 | 3300021359 | Seawater | VKKKSDKRVKKEAYWFRLQEVAQKYRNVLFVNADNVSSL |
Ga0206689_111141451 | 3300021359 | Seawater | KSQKRIKKENYWNRLQMVAQKYKNVLFVDADMVSSKQIA |
Ga0206123_103301932 | 3300021365 | Seawater | MPAVKKSEKRLKKEAYWKRLQETARKYKNALFVDVNNVSSK |
Ga0063132_1057311 | 3300021872 | Marine | MPVAKKSEKRIKKENYWRRLQITARKYKNALFINANHVSSK |
Ga0063132_1307341 | 3300021872 | Marine | MAVKKKSEKRLKKEAYWFRLQDVAAKYKNVMFVSADNVSSK |
Ga0063147_1135091 | 3300021874 | Marine | AVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0063146_1212031 | 3300021875 | Marine | KKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0063113_1095551 | 3300021879 | Marine | LSFRMAVKKKSEKRIKKEAYWTRLQQVAQKYRNVLFVNADNVSSL |
Ga0063105_10069451 | 3300021887 | Marine | YKMPLAVKKSEKRIKKEAYWKRLQETARTYKNALFVDANNVSSK |
Ga0063105_10149091 | 3300021887 | Marine | PAEVKKSEKRIKKEAYWGRLQETCRKHRNALFVDANNVSSK |
Ga0063105_10157211 | 3300021887 | Marine | RMPKIVKSDKRIKKEKYWARLQHIVANYKNAAFIDANNVSSK |
Ga0063105_10728711 | 3300021887 | Marine | KKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0063089_10318301 | 3300021889 | Marine | NKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0063090_10312181 | 3300021890 | Marine | KMPAEVKKSEKRIKKEAYWGRLQETCRKHRNALFVDANNVSSK |
Ga0063136_11097591 | 3300021896 | Marine | KKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0063097_10430291 | 3300021898 | Marine | MPKIVKSDKRIKKEKYWARLQHIVANYKNAAFIDANNVSSK |
Ga0063144_10075401 | 3300021899 | Marine | KQMPAVKKSEKRLKKEAYWKRLQETARKYKNALFVDANNVSSK |
Ga0063086_10139621 | 3300021902 | Marine | ETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0063088_10091231 | 3300021905 | Marine | KNKMPAVKKSDKRIKKEAYWGRLQETCRKYKNALFVDANNVSSK |
Ga0063088_10294031 | 3300021905 | Marine | MAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0063087_10036711 | 3300021906 | Marine | NRMPAEVKKSEKRIKKEAYWGRLQETCRKHRNALFVDANNVSSK |
Ga0063100_10398601 | 3300021910 | Marine | KMPAAVKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK |
Ga0063100_10564571 | 3300021910 | Marine | PKIVKSDKRIKKEKYWARLQHIVANYKNAAFIDANNVSSK |
Ga0063106_10326351 | 3300021911 | Marine | NKMPAAVKKSDKRIKKEAYWGRLQETARKYKNALFVDANNVSSK |
Ga0063106_10447541 | 3300021911 | Marine | NKMPQAVKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK |
Ga0063104_10354131 | 3300021913 | Marine | TNKMAVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0063870_10033611 | 3300021921 | Marine | NKMPAEVKKSEKRIKKEAYWGRLQETCRKHRNALFVDANNVSSK |
Ga0063103_10688561 | 3300021927 | Marine | NKMAVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0063139_10583421 | 3300021934 | Marine | KMPAVKKSDKRLKKEAYWGRLQETARKYKNALFVDANNVSSK |
Ga0063754_10036971 | 3300021937 | Marine | RMPAEVKKSEKRIKKEAYWGRLQETCRKHRNALFVDANNVSSK |
Ga0063102_10018131 | 3300021941 | Marine | YKMPLEVKKSEKRIKKEAYWKRLQETARTYKNALFVDANNVSSK |
Ga0063102_10124241 | 3300021941 | Marine | LNKMPAAVKKSDKRIKKEAYWGRLQETARKYKNALFVDANNVSSK |
Ga0063102_10146911 | 3300021941 | Marine | KMPAEVKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK |
Ga0063101_10259481 | 3300021950 | Marine | MPAEVKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK |
Ga0063101_11460211 | 3300021950 | Marine | MAVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0222713_102989371 | 3300021962 | Estuarine Water | MPVIAASKGAKKSEKRVKKEAFWIRIQRVAQKFKNCLFVDVENVSS |
Ga0209631_102239161 | 3300025890 | Pelagic Marine | MTVAKKSDKRVRKEAYWHRLQDVVGKHKNVLFVDVDNVSSKQIG |
Ga0209631_102580471 | 3300025890 | Pelagic Marine | MPVAKKSDKRIKKENYWKRLQETARKYKNALFVDANNVSSK |
Ga0247594_10161781 | 3300026448 | Seawater | KKSAQRIKKEAYWQRLIDVAGKYNNALFVDSDNVSSK |
Ga0247593_10252211 | 3300026449 | Seawater | MPVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK |
Ga0247588_10214042 | 3300026465 | Seawater | KKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK |
Ga0247592_10583214 | 3300026500 | Seawater | VKKSDKRLKKEAYWGRLQDTARKYKNALFVDANNVSSN |
Ga0247592_11360252 | 3300026500 | Seawater | SHSIMPGVKKSEKRIKKEAYWKRLQVTARKYKNCLFVDANNVSSK |
Ga0247590_10564301 | 3300026513 | Seawater | KMPGVKKSEKRIKKEAYWKRLQVTARKYKNCLFVDANNVSSK |
Ga0209092_104384631 | 3300027833 | Marine | MPAEVKKSEKRIKKEAYWGRLQETCRKHRNALFVDANNVSSK |
Ga0209712_101268632 | 3300027849 | Marine | MPAAVKKSDKRIKKEAYWGRLQETARKYKNALFVDANNVSSK |
Ga0247582_10452411 | 3300028109 | Seawater | IQMPVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK |
Ga0247584_10416251 | 3300028110 | Seawater | TIQMPVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK |
Ga0256412_10991061 | 3300028137 | Seawater | KMPAVKKTAKRIKKENYWRRIQQVAYKYNNVLFVNADNVSSK |
Ga0256412_13939001 | 3300028137 | Seawater | MSAVNKSEKRLKKESRWRRVQEIAYKYNNVLFVDANNVSSN |
Ga0256413_10753392 | 3300028282 | Seawater | VKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK |
Ga0304731_101156353 | 3300028575 | Marine | KVRMAVKKKSEKRIKKEAYWTRLQQVAQKYRNVLFVNADNVSSL |
Ga0307402_102006071 | 3300030653 | Marine | YQLKMPKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK |
Ga0307403_101654541 | 3300030671 | Marine | MPAAKKSDKRIKKEAYWGRLQETARKYKNALFVDANNVSSK |
Ga0307403_107037372 | 3300030671 | Marine | MAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK |
Ga0307399_100916161 | 3300030702 | Marine | MAVKKKSDKRIKKEAYWVRLQQVAMKYRNVLFVNADNVSSL |
Ga0307400_108221271 | 3300030709 | Marine | MPKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK |
Ga0308129_10075721 | 3300030723 | Marine | KMAVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0308128_10097512 | 3300030725 | Marine | AVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0073981_109746642 | 3300030857 | Marine | KKSEKRIRKEANWHKVQDAVEKYKNCLFVDADNVSSK |
Ga0308143_1067331 | 3300031540 | Marine | KKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK |
Ga0308144_10110521 | 3300031570 | Marine | NKMPAEVKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK |
Ga0308132_10299144 | 3300031580 | Marine | KKSEKRIKKEAYWFRLQEVAQKYRNVLFVNADNVSSL |
Ga0308132_10520121 | 3300031580 | Marine | KMPQAVKKSEKRIKKEAYWKRLQETARTYKNALFVDANNVSSK |
Ga0302126_100784242 | 3300031622 | Marine | VKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK |
Ga0307393_10261161 | 3300031674 | Marine | KGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK |
Ga0307393_10293721 | 3300031674 | Marine | ILKMVVKKKSEKRVKKENYWDRIQEVAVKYKNVLFINSDNVSSLQICKLR |
Ga0307393_10341004 | 3300031674 | Marine | FRMAVKKKSDKRIKKEAYWVRLQQVAMKYRNVLFVNADNVSSL |
Ga0307385_100992961 | 3300031709 | Marine | QMPAVKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK |
Ga0307386_101366421 | 3300031710 | Marine | KQMPAVKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK |
Ga0307386_101391814 | 3300031710 | Marine | YYLSFRMAVKKKSDKRIKKEAYWVRLQQVAMKYRNVLFVNADNVSSL |
Ga0307386_102721711 | 3300031710 | Marine | KKSDRRVKKENYWNRLIMVAYKYKNVLFVNADNVSSLQICKLR |
Ga0307386_106627201 | 3300031710 | Marine | NMPAAKKSEKRVKKEAYWKRLQETARKYKNALFVDANNVSSK |
Ga0307396_102453001 | 3300031717 | Marine | LSFRMAVKKKSDKRIKKEAYWVRLQQVAMKYRNVLFVNADNVSSL |
Ga0307381_100632661 | 3300031725 | Marine | RMPVKKKSEKRIKKENYWDRIQEVAYKYKNVLFINPDNVSSLQICKLR |
Ga0307381_100685311 | 3300031725 | Marine | LNKPAQKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK |
Ga0307381_100840111 | 3300031725 | Marine | QMPAVKKSEKRLKKEAYWKRLQETARKYKNALFVDANNVSSK |
Ga0307381_102035004 | 3300031725 | Marine | SILKMVVKKKSDRRVKKENYWNRLIMVAYKYKNVLFVNADNVSSLQICKLR |
Ga0307391_101841581 | 3300031729 | Marine | KRMPKIVKSDKRIKKEKYWGRLQHIVANYKNAAFIDANNVSSK |
Ga0307391_108334322 | 3300031729 | Marine | LKMVVKKKSEKRVKKENYWDRIQEVAVKYKNVLFINSDNVSSLQICKLR |
Ga0307397_101808631 | 3300031734 | Marine | PKIVKSDKRIKKEKYWGRLQHIVANYKNAAFIDANNVSSK |
Ga0307394_100878111 | 3300031735 | Marine | YILKMVVKKKSEKRVKKENYWDRIQEVAVKYKNVLFINSDNVSSLQICKLR |
Ga0307394_101191653 | 3300031735 | Marine | MPAAKKSEKRIKKEAYWRRLQETARKYKNALIVDANNVSSK |
Ga0307384_101222611 | 3300031738 | Marine | ILKMVVKKKSDRRVKKENYWNRLIMVAYKYKNVLFVNADNVSSL |
Ga0307384_101319741 | 3300031738 | Marine | MPVAKKSDKRVKKEAYWKRLVYTAETYKNVMFVNANNVSSK |
Ga0307384_101684981 | 3300031738 | Marine | MPAAKKSEKRVKKEAYWKRLQETARKYKNALFVDANNVSSK |
Ga0307383_101257271 | 3300031739 | Marine | VKLNMPAQKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK |
Ga0307383_101258201 | 3300031739 | Marine | MPAVKKSEKRLKKEAYWKRLQETARKYKNALFVDANNVSSK |
Ga0307383_101314544 | 3300031739 | Marine | MPVKKKSEKRIKKEAHWVKIQEAAEKYKNCLFVDADNVSSK |
Ga0307383_101422914 | 3300031739 | Marine | LKMVVKKKSDRRVKKENYWNRLIMVAYKYKNVLFVNADNVSSLQICKLR |
Ga0307395_104043931 | 3300031742 | Marine | TKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK |
Ga0307382_101095621 | 3300031743 | Marine | LNMPAQKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK |
Ga0307382_101653586 | 3300031743 | Marine | VKKKSDRRVKKENYWNRLIMVAYKYKNVLFVNADNVSSLQICKLR |
Ga0307404_100956481 | 3300031752 | Marine | MAIKKKSDKRVKKENYYVRLQEVAAKYKNCLFVNADNVSSL |
Ga0314675_101230041 | 3300032491 | Seawater | KETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0314679_100952471 | 3300032492 | Seawater | LFKIPIYFIIEYIKETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0314688_101361481 | 3300032517 | Seawater | NKMAVKKKSDKRIKKEAYWFRLQDAAAKYNNVMFVDANNVSSK |
Ga0314688_101594401 | 3300032517 | Seawater | KMPAEKKSEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK |
Ga0314676_101729771 | 3300032519 | Seawater | ETNKMAVKKKSDKRIKKEAYWFRLQDAAAKYNNVMFVDANNVSSK |
Ga0314673_101238791 | 3300032650 | Seawater | PAEKKSEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK |
Ga0314685_102111021 | 3300032651 | Seawater | MPAEKKSEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK |
Ga0314669_101131371 | 3300032708 | Seawater | LFKIPFYFIIEYIKETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0314672_10691881 | 3300032709 | Seawater | IKETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0314702_13872571 | 3300032725 | Seawater | TNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK |
Ga0314699_101142193 | 3300032730 | Seawater | EKKSEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK |
Ga0314709_102112881 | 3300032755 | Seawater | KETNKMAVKKKSDKRIKKEAYWFRLQDAAAKYNNVMFVDANNVSSK |
Ga0307390_102011521 | 3300033572 | Marine | FKRMAIKKKSDKRVKKENYYVRLQEVAAKYKNCLFVNADNVSSL |
⦗Top⦘ |