NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028311

Metagenome / Metatranscriptome Family F028311

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028311
Family Type Metagenome / Metatranscriptome
Number of Sequences 192
Average Sequence Length 43 residues
Representative Sequence MPAAKKSEKRIKKEAYWRRLQETARKYKNALFVDANNVSSK
Number of Associated Samples 140
Number of Associated Scaffolds 192

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 4.69 %
% of genes near scaffold ends (potentially truncated) 84.38 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (86.458 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(42.188 % of family members)
Environment Ontology (ENVO) Unclassified
(68.750 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(71.354 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.88%    β-sheet: 0.00%    Coil/Unstructured: 68.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 192 Family Scaffolds
PF00466Ribosomal_L10 52.60
PF00428Ribosomal_60s 7.29
PF01551Peptidase_M23 0.52
PF00160Pro_isomerase 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 192 Family Scaffolds
COG0244Ribosomal protein L10Translation, ribosomal structure and biogenesis [J] 52.60
COG2058Ribosomal protein L12E/L44/L45/RPP1/RPP2Translation, ribosomal structure and biogenesis [J] 7.29
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.98 %
UnclassifiedrootN/A13.02 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000368|DelMOSpr2010DRAFT_102454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1047Open in IMG/M
3300003714|Ga0008272_104944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae933Open in IMG/M
3300006165|Ga0075443_10317483Not Available574Open in IMG/M
3300006357|Ga0075502_1624829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1149Open in IMG/M
3300006382|Ga0075494_1001436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1134Open in IMG/M
3300006383|Ga0075504_1329375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1129Open in IMG/M
3300006392|Ga0075507_1414475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1055Open in IMG/M
3300006399|Ga0075495_1510467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1118Open in IMG/M
3300006400|Ga0075503_1651174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1151Open in IMG/M
3300006401|Ga0075506_1744056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1147Open in IMG/M
3300006571|Ga0075505_1326375Not Available770Open in IMG/M
3300008934|Ga0103737_1002043All Organisms → cellular organisms → Eukaryota1820Open in IMG/M
3300008952|Ga0115651_1164796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1536Open in IMG/M
3300008993|Ga0104258_1079634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae612Open in IMG/M
3300009432|Ga0115005_10225660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1464Open in IMG/M
3300009543|Ga0115099_10002799Not Available559Open in IMG/M
3300009543|Ga0115099_10634235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1087Open in IMG/M
3300009599|Ga0115103_1287215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1147Open in IMG/M
3300009599|Ga0115103_1343384Not Available972Open in IMG/M
3300009599|Ga0115103_1404303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae981Open in IMG/M
3300009599|Ga0115103_1653762All Organisms → cellular organisms → Eukaryota1004Open in IMG/M
3300009606|Ga0115102_10889388Not Available615Open in IMG/M
3300009608|Ga0115100_10228027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1123Open in IMG/M
3300009677|Ga0115104_10052294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1146Open in IMG/M
3300009677|Ga0115104_10162704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora906Open in IMG/M
3300009677|Ga0115104_10196061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1082Open in IMG/M
3300009677|Ga0115104_10730829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae656Open in IMG/M
3300009679|Ga0115105_10473704Not Available1084Open in IMG/M
3300010981|Ga0138316_10532858Not Available1080Open in IMG/M
3300012408|Ga0138265_1105167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1173Open in IMG/M
3300012408|Ga0138265_1283581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae558Open in IMG/M
3300012412|Ga0138266_1015963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae672Open in IMG/M
3300012414|Ga0138264_1241952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1178Open in IMG/M
3300012415|Ga0138263_1443267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae990Open in IMG/M
3300012416|Ga0138259_1456813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae580Open in IMG/M
3300012416|Ga0138259_1609814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae514Open in IMG/M
3300012418|Ga0138261_1286382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae576Open in IMG/M
3300012418|Ga0138261_1796751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1158Open in IMG/M
3300012472|Ga0129328_1117281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae947Open in IMG/M
3300012767|Ga0138267_1162875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora1171Open in IMG/M
3300012782|Ga0138268_1114045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1178Open in IMG/M
3300012782|Ga0138268_1121750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae707Open in IMG/M
3300016703|Ga0182088_1019041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1147Open in IMG/M
3300016703|Ga0182088_1320721Not Available985Open in IMG/M
3300016723|Ga0182085_1222895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1141Open in IMG/M
3300016740|Ga0182096_1132402Not Available1149Open in IMG/M
3300016746|Ga0182055_1210384Not Available667Open in IMG/M
3300016766|Ga0182091_1139475Not Available1158Open in IMG/M
3300016781|Ga0182063_1666131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1107Open in IMG/M
3300018515|Ga0192960_101180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora1153Open in IMG/M
3300018628|Ga0193355_1002547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1319Open in IMG/M
3300018684|Ga0192983_1008282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1207Open in IMG/M
3300018692|Ga0192944_1009526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1223Open in IMG/M
3300018692|Ga0192944_1012544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora1118Open in IMG/M
3300018730|Ga0192967_1011013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1304Open in IMG/M
3300018739|Ga0192974_1049520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae717Open in IMG/M
3300018823|Ga0193053_1013634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1234Open in IMG/M
3300018825|Ga0193048_1058446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae584Open in IMG/M
3300018831|Ga0192949_1028167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1141Open in IMG/M
3300018846|Ga0193253_1030865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1292Open in IMG/M
3300018846|Ga0193253_1038665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1172Open in IMG/M
3300018871|Ga0192978_1024284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1121Open in IMG/M
3300018871|Ga0192978_1025823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1090Open in IMG/M
3300018926|Ga0192989_10036773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1237Open in IMG/M
3300018926|Ga0192989_10047631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1096Open in IMG/M
3300018975|Ga0193006_10094997All Organisms → cellular organisms → Eukaryota893Open in IMG/M
3300018980|Ga0192961_10041371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1292Open in IMG/M
3300018980|Ga0192961_10047540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1223Open in IMG/M
3300018989|Ga0193030_10029199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1290Open in IMG/M
3300019031|Ga0193516_10069019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1193Open in IMG/M
3300019032|Ga0192869_10088416Not Available1166Open in IMG/M
3300019036|Ga0192945_10044798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1244Open in IMG/M
3300019048|Ga0192981_10082676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1233Open in IMG/M
3300019116|Ga0193243_1007450Not Available1215Open in IMG/M
3300019123|Ga0192980_1020110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1239Open in IMG/M
3300019149|Ga0188870_10035671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1174Open in IMG/M
3300019153|Ga0192975_10070568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1241Open in IMG/M
3300019153|Ga0192975_10088749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1117Open in IMG/M
3300019261|Ga0182097_1111553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1126Open in IMG/M
3300019261|Ga0182097_1318822Not Available1150Open in IMG/M
3300019272|Ga0182059_1752882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1087Open in IMG/M
3300021169|Ga0206687_1720186Not Available1143Open in IMG/M
3300021342|Ga0206691_1715185All Organisms → cellular organisms → Eukaryota1217Open in IMG/M
3300021348|Ga0206695_1018040Not Available574Open in IMG/M
3300021353|Ga0206693_1798138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1235Open in IMG/M
3300021359|Ga0206689_11039750Not Available813Open in IMG/M
3300021359|Ga0206689_11114145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae829Open in IMG/M
3300021365|Ga0206123_10330193Not Available642Open in IMG/M
3300021872|Ga0063132_105731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1135Open in IMG/M
3300021872|Ga0063132_130734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae510Open in IMG/M
3300021874|Ga0063147_113509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae580Open in IMG/M
3300021875|Ga0063146_121203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1113Open in IMG/M
3300021879|Ga0063113_109555All Organisms → cellular organisms → Eukaryota837Open in IMG/M
3300021887|Ga0063105_1006945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1173Open in IMG/M
3300021887|Ga0063105_1014909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1116Open in IMG/M
3300021887|Ga0063105_1015721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1046Open in IMG/M
3300021887|Ga0063105_1072871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae571Open in IMG/M
3300021889|Ga0063089_1031830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1128Open in IMG/M
3300021890|Ga0063090_1031218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1125Open in IMG/M
3300021896|Ga0063136_1109759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae990Open in IMG/M
3300021898|Ga0063097_1043029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora875Open in IMG/M
3300021899|Ga0063144_1007540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1127Open in IMG/M
3300021902|Ga0063086_1013962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1155Open in IMG/M
3300021905|Ga0063088_1009123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae625Open in IMG/M
3300021905|Ga0063088_1029403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1082Open in IMG/M
3300021906|Ga0063087_1003671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1153Open in IMG/M
3300021910|Ga0063100_1039860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1146Open in IMG/M
3300021910|Ga0063100_1056457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae966Open in IMG/M
3300021911|Ga0063106_1032635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae854Open in IMG/M
3300021911|Ga0063106_1044754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1131Open in IMG/M
3300021913|Ga0063104_1035413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1114Open in IMG/M
3300021921|Ga0063870_1003361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1151Open in IMG/M
3300021927|Ga0063103_1068856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1137Open in IMG/M
3300021934|Ga0063139_1058342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1011Open in IMG/M
3300021937|Ga0063754_1003697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1150Open in IMG/M
3300021941|Ga0063102_1001813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae857Open in IMG/M
3300021941|Ga0063102_1012424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1158Open in IMG/M
3300021941|Ga0063102_1014691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1153Open in IMG/M
3300021950|Ga0063101_1025948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1154Open in IMG/M
3300021950|Ga0063101_1146021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae511Open in IMG/M
3300021962|Ga0222713_10298937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1026Open in IMG/M
3300025890|Ga0209631_10223916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea953Open in IMG/M
3300025890|Ga0209631_10258047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae865Open in IMG/M
3300026448|Ga0247594_1016178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1194Open in IMG/M
3300026449|Ga0247593_1025221Not Available1139Open in IMG/M
3300026465|Ga0247588_1021404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1219Open in IMG/M
3300026500|Ga0247592_1058321All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300026500|Ga0247592_1136025Not Available587Open in IMG/M
3300026513|Ga0247590_1056430All Organisms → cellular organisms → Eukaryota1010Open in IMG/M
3300027833|Ga0209092_10438463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae677Open in IMG/M
3300027849|Ga0209712_10126863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1464Open in IMG/M
3300028109|Ga0247582_1045241Not Available1144Open in IMG/M
3300028110|Ga0247584_1041625Not Available1151Open in IMG/M
3300028137|Ga0256412_1099106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1058Open in IMG/M
3300028137|Ga0256412_1393900Not Available508Open in IMG/M
3300028282|Ga0256413_1075339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1205Open in IMG/M
3300028575|Ga0304731_10115635Not Available1080Open in IMG/M
3300030653|Ga0307402_10200607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1108Open in IMG/M
3300030671|Ga0307403_10165454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1136Open in IMG/M
3300030671|Ga0307403_10703737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae549Open in IMG/M
3300030702|Ga0307399_10091616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1262Open in IMG/M
3300030709|Ga0307400_10822127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae573Open in IMG/M
3300030723|Ga0308129_1007572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1136Open in IMG/M
3300030725|Ga0308128_1009751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1109Open in IMG/M
3300030857|Ga0073981_10974664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora692Open in IMG/M
3300031540|Ga0308143_106733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1155Open in IMG/M
3300031570|Ga0308144_1011052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1150Open in IMG/M
3300031580|Ga0308132_1029914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1137Open in IMG/M
3300031580|Ga0308132_1052012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae852Open in IMG/M
3300031622|Ga0302126_10078424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1322Open in IMG/M
3300031674|Ga0307393_1026116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1125Open in IMG/M
3300031674|Ga0307393_1029372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1073Open in IMG/M
3300031674|Ga0307393_1034100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1009Open in IMG/M
3300031709|Ga0307385_10099296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1073Open in IMG/M
3300031710|Ga0307386_10136642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1125Open in IMG/M
3300031710|Ga0307386_10139181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1117Open in IMG/M
3300031710|Ga0307386_10272171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea842Open in IMG/M
3300031710|Ga0307386_10662720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae556Open in IMG/M
3300031717|Ga0307396_10245300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii853Open in IMG/M
3300031725|Ga0307381_10063266Not Available1152Open in IMG/M
3300031725|Ga0307381_10068531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1116Open in IMG/M
3300031725|Ga0307381_10084011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1025Open in IMG/M
3300031725|Ga0307381_10203500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea693Open in IMG/M
3300031729|Ga0307391_10184158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1086Open in IMG/M
3300031729|Ga0307391_10833432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae530Open in IMG/M
3300031734|Ga0307397_10180863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae925Open in IMG/M
3300031735|Ga0307394_10087811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1160Open in IMG/M
3300031735|Ga0307394_10119165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1009Open in IMG/M
3300031738|Ga0307384_10122261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1088Open in IMG/M
3300031738|Ga0307384_10131974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1055Open in IMG/M
3300031738|Ga0307384_10168498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae951Open in IMG/M
3300031739|Ga0307383_10125727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1159Open in IMG/M
3300031739|Ga0307383_10125820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1159Open in IMG/M
3300031739|Ga0307383_10131454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora1137Open in IMG/M
3300031739|Ga0307383_10142291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1099Open in IMG/M
3300031742|Ga0307395_10404393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae594Open in IMG/M
3300031743|Ga0307382_10109562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1171Open in IMG/M
3300031743|Ga0307382_10165358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea970Open in IMG/M
3300031752|Ga0307404_10095648All Organisms → cellular organisms → Eukaryota1163Open in IMG/M
3300032491|Ga0314675_10123004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1203Open in IMG/M
3300032492|Ga0314679_10095247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1279Open in IMG/M
3300032517|Ga0314688_10136148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1182Open in IMG/M
3300032517|Ga0314688_10159440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1114Open in IMG/M
3300032519|Ga0314676_10172977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1191Open in IMG/M
3300032650|Ga0314673_10123879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1160Open in IMG/M
3300032651|Ga0314685_10211102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1052Open in IMG/M
3300032708|Ga0314669_10113137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1262Open in IMG/M
3300032709|Ga0314672_1069188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1222Open in IMG/M
3300032725|Ga0314702_1387257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae524Open in IMG/M
3300032730|Ga0314699_10114219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1114Open in IMG/M
3300032755|Ga0314709_10211288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae1166Open in IMG/M
3300033572|Ga0307390_10201152All Organisms → cellular organisms → Eukaryota1144Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine42.19%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine21.88%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.25%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine6.25%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.73%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.21%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.69%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.12%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.04%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.52%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.52%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.52%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.52%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.52%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.52%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000368Marine microbial communities from Delaware Coast, sample from Delaware MO Late spring/early summerEnvironmentalOpen in IMG/M
3300003714Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016781Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021875Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S30 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021879Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021906Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021937Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Euk ARK-20-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031570Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010DRAFT_10245413300000368MarineAEKKSEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK*
Ga0008272_10494413300003714MarineAVKKKSEKRIKKEAYWTRLQVVAQKYNNVLFVDADNVSSKQIAKDQS*
Ga0075443_1031748323300006165MarineMAVKKKSAQRIKKEAYWFRLIDVAGKYKNALFVDSDNVSSK*
Ga0075502_162482913300006357AqueousSIMPGVKKSEKRIKKEAYWKRLQVTARTYKNCLFVDANNVSSK*
Ga0075494_100143613300006382AqueousMPAEKKSEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK*
Ga0075504_132937513300006383AqueousPGVKKSEKRIKKEAYWKRLQVTARTYKNCLFVDANNVSSK*
Ga0075507_141447533300006392AqueousLHSIMPGVKKSEKRIKKEAYWKRLQVTARTYKNCLFVDANNVSSK*
Ga0075495_151046713300006399AqueousQMPAVKKSEKRLKKEAYWKRLQETARKYKNALFVDANNVSSK*
Ga0075503_165117433300006400AqueousHSIMPGVKKSEKRIKKEAYWKRLQVTARTYKNCLFVDANNVSSK*
Ga0075506_174405633300006401AqueousIMPGVKKSEKRIKKEAYWKRLQVTARTYKNCLFVDANNVSSK*
Ga0075505_132637533300006571AqueousGVKKSEKRIKKEAYWKRLQVTARTYKNCLFVDANNVSSK*
Ga0103737_100204313300008934Ice Edge, Mcmurdo Sound, AntarcticaAQRIKKEAYWFRLIDVAGKYKNALFVDSDNVSSK*
Ga0115651_116479623300008952MarineMAVKKKSEKRIKKENYWKRLQDVAHKYNNVLFINADNVSSL*
Ga0104258_107963423300008993Ocean WaterLIYYLSFKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK*
Ga0115005_1022566023300009432MarineMPAAVKKSDKRIKKEAYWGRLQETARKYKNALFVDANNVSSK*
Ga0115099_1000279913300009543MarineMPVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK*
Ga0115099_1063423513300009543MarineLSFKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK*
Ga0115103_128721513300009599MarineNKMPAVKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK*
Ga0115103_134338413300009599MarineQMPVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK*
Ga0115103_140430313300009599MarineMPAVKKTAKRIKKENYWRRIQQVAYKYNNVLFVNADNVSSK*
Ga0115103_165376213300009599MarineYYLSFKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK*
Ga0115102_1088938813300009606MarinePVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK*
Ga0115100_1022802713300009608MarineKMPAVKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK*
Ga0115104_1005229423300009677MarinePVAKKSEKRIKKEAYWERLQITARKYKNALFVNANNVSSK*
Ga0115104_1016270423300009677MarineMPAVKKTAKRIKKENYWRRIQQVAFKYNNVLFVNADNVSSL*
Ga0115104_1019606133300009677MarineMSAVNKSEKRLKKESRWRRVQEIAYKYNNVLFVDANNVSSN*
Ga0115104_1073082913300009677MarineKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK*
Ga0115105_1047370443300009679MarineVKKKSDKRVKKEAYWFRLQEVAQKYRNVLFVNADNVSSL*
Ga0138316_1053285833300010981MarineKVRMAVKKKSEKRIKKEAYWTRLQQVAQKYRNVLFVNADNVSSL*
Ga0138265_110516723300012408Polar MarinePAAKKSEKRIKKEAYWRRLQETARKYKNALFVDANNVSSK*
Ga0138265_128358113300012408Polar MarineSEKRIKKEAYWVRLQDVAAKYNNIMFVDANNVSSK*
Ga0138266_101596313300012412Polar MarineKMAIKKKSEKRIKKEAYWVRLQDVAAKYNNIMFVDANNVSSK*
Ga0138264_124195223300012414Polar MarineKETNKMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK*
Ga0138263_144326723300012415Polar MarineYQLKMPKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK*
Ga0138259_145681323300012416Polar MarineAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK*
Ga0138259_160981413300012416Polar MarineKMAVKKKSERRIKKENYWKRLQVVAHKYQNVLFVDGDNVSSQQI*
Ga0138261_128638213300012418Polar MarinePKIVKSDKRIKKEKYWGRLQHIVANYKNAAFIDANNVSSK*
Ga0138261_179675113300012418Polar MarineAAKKSEKRVKKEAYWRRLQETARKYKNALFVDANNVSSK*
Ga0129328_111728123300012472AqueousEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK*
Ga0138267_116287513300012767Polar MarineNKMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK*
Ga0138268_111404513300012782Polar MarineIKETNKMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK*
Ga0138268_112175013300012782Polar MarineIKMAVKKKSAQRIKKEAYWFRLIDVAGKYKNALFVDSDNVSSK*
Ga0182088_101904113300016703Salt MarshIMLGVKKSEKRIKKEAYWKRLQVTTRTYKNCLFVDANNVSSK
Ga0182088_132072133300016703Salt MarshMPQPIKKSEKRIKKEAYWKRLQVTARKYRNCLFVDANNVSS
Ga0182085_122289513300016723Salt MarshIMPGVKKSEKRIKKEAYWKRLQVTTRTYKNCLFVDANNVSSK
Ga0182096_113240213300016740Salt MarshITQMPQPIKKSEKRIKKEAYWKRLQVTARKYRNCLFVDANNVSS
Ga0182055_121038433300016746Salt MarshKKSEKRIKKEAYWKRLQVTARKYKNCLFVDANNVSSK
Ga0182091_113947513300016766Salt MarshLITQMPQPIKKSEKRIKKEAYWKRLQVTARKYRNCLFVDANNVSS
Ga0182063_166613113300016781Salt MarshMPVAKKSEKRIKKEAYWKRLQVTARKYKNCLFVDANNVSSK
Ga0192960_10118023300018515MarineSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK
Ga0193355_100254713300018628MarineMPAAKKSEKRLKKETLWRKLQTLAFKYKNALFVDADNVSSKQISMLR
Ga0192983_100828213300018684MarineMGIEYIKETNKMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK
Ga0192944_100952623300018692MarineMGIIEYIKETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0192944_101254413300018692MarineMGIIEYIKETNKMVVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0192967_101101313300018730MarineMAVKKKSAQRIKKEAYWFRLIDVAGKYKNALFVDSDNVSSK
Ga0192974_104952023300018739MarineMPAAKKSEKRIKKEAYWRRLQETARKYKNALFVDANNVSSK
Ga0193053_101363413300018823MarineMAVKKKSAARIKKEAYWHRLIDVAGKYKNALFVDSDNVSSK
Ga0193048_105844623300018825MarineSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0192949_102816713300018831MarineETNKMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK
Ga0193253_103086523300018846MarineYYLSFKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK
Ga0193253_103866523300018846MarineKETNKMAVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0192978_102428413300018871MarineKMVVKKKSEKRVKKENYWDRIQEVAVKYKNVLFINSDNVSSLQICKLR
Ga0192978_102582313300018871MarineLKMPKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK
Ga0192989_1003677313300018926MarineLSFKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK
Ga0192989_1004763123300018926MarineKAKMGVKKSQKRINKEAFWTRLQMVSRKYRQVMFVDANQVSSLQIAKIR
Ga0193006_1009499713300018975MarineMAVKKKSEKRIKKENYWKRLQDVARKYTNVLFINADNVSSL
Ga0192961_1004137123300018980MarineMAVKKKSAQRIKKEAYWLRLIEVAGKYKNALFVDSDNVSSK
Ga0192961_1004754023300018980MarineMGIIEYIKETNKMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK
Ga0193030_1002919943300018989MarineMAVKKKSEKRIKKENYWRRLQDVARKYTNVLFINADNVSSL
Ga0193516_1006901933300019031MarineMAVKKKSEKRIKKEAYWKRLQDVAQKYRNVLFVNADNVSSL
Ga0192869_1008841643300019032MarineMAVKKKSEKRIKKEAYWVRLQQVAQKYRNVLFVNADNVSSL
Ga0192945_1004479823300019036MarineEYMGIIEYIKETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0192981_1008267623300019048MarineYMGIIIFNSYQLKMPKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK
Ga0193243_100745043300019116MarineHKNMPAVKKSEKRLKKEALWRKLQTYAFKYKNALFVDANNVSSK
Ga0192980_102011023300019123MarineMGIIIFNSYQLKMPKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK
Ga0188870_1003567113300019149Freshwater LakeKMPVAKKSDKRIKKENYWRRLQETARKYKNALFVDANNVSSK
Ga0192975_1007056823300019153MarineKMAVKKKSAQRIKKEAYWFRLIDVAGKYKNALFVDSDNVSSK
Ga0192975_1008874913300019153MarineKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK
Ga0182097_111155313300019261Salt MarshGVKKSEKRIKKEAYWKRLQVTTRTYKNCLFVDANNVSSK
Ga0182097_131882213300019261Salt MarshQMPQPIKKSEKRIKKEAYWKRLQVTTRKYRNCLFIDANNVSS
Ga0182059_175288213300019272Salt MarshKSEKRIKKEAYWKRLQVTARKYKNCLFVDANNVSSK
Ga0206687_172018613300021169SeawaterQMPVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK
Ga0206691_171518513300021342SeawaterLSFLRMAVQKKSAKRVKKENYWRRLQVTAGKYKNALFIDANNVSSNQIGKIR
Ga0206695_101804013300021348SeawaterLKKMPKIVKSEKRIKKEKYWARLQKTAETYKYAAFIDANNVSSKQICMIR
Ga0206693_179813823300021353SeawaterSFKKMAVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK
Ga0206689_1103975013300021359SeawaterVKKKSDKRVKKEAYWFRLQEVAQKYRNVLFVNADNVSSL
Ga0206689_1111414513300021359SeawaterKSQKRIKKENYWNRLQMVAQKYKNVLFVDADMVSSKQIA
Ga0206123_1033019323300021365SeawaterMPAVKKSEKRLKKEAYWKRLQETARKYKNALFVDVNNVSSK
Ga0063132_10573113300021872MarineMPVAKKSEKRIKKENYWRRLQITARKYKNALFINANHVSSK
Ga0063132_13073413300021872MarineMAVKKKSEKRLKKEAYWFRLQDVAAKYKNVMFVSADNVSSK
Ga0063147_11350913300021874MarineAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0063146_12120313300021875MarineKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0063113_10955513300021879MarineLSFRMAVKKKSEKRIKKEAYWTRLQQVAQKYRNVLFVNADNVSSL
Ga0063105_100694513300021887MarineYKMPLAVKKSEKRIKKEAYWKRLQETARTYKNALFVDANNVSSK
Ga0063105_101490913300021887MarinePAEVKKSEKRIKKEAYWGRLQETCRKHRNALFVDANNVSSK
Ga0063105_101572113300021887MarineRMPKIVKSDKRIKKEKYWARLQHIVANYKNAAFIDANNVSSK
Ga0063105_107287113300021887MarineKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0063089_103183013300021889MarineNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0063090_103121813300021890MarineKMPAEVKKSEKRIKKEAYWGRLQETCRKHRNALFVDANNVSSK
Ga0063136_110975913300021896MarineKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0063097_104302913300021898MarineMPKIVKSDKRIKKEKYWARLQHIVANYKNAAFIDANNVSSK
Ga0063144_100754013300021899MarineKQMPAVKKSEKRLKKEAYWKRLQETARKYKNALFVDANNVSSK
Ga0063086_101396213300021902MarineETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0063088_100912313300021905MarineKNKMPAVKKSDKRIKKEAYWGRLQETCRKYKNALFVDANNVSSK
Ga0063088_102940313300021905MarineMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0063087_100367113300021906MarineNRMPAEVKKSEKRIKKEAYWGRLQETCRKHRNALFVDANNVSSK
Ga0063100_103986013300021910MarineKMPAAVKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK
Ga0063100_105645713300021910MarinePKIVKSDKRIKKEKYWARLQHIVANYKNAAFIDANNVSSK
Ga0063106_103263513300021911MarineNKMPAAVKKSDKRIKKEAYWGRLQETARKYKNALFVDANNVSSK
Ga0063106_104475413300021911MarineNKMPQAVKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK
Ga0063104_103541313300021913MarineTNKMAVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0063870_100336113300021921MarineNKMPAEVKKSEKRIKKEAYWGRLQETCRKHRNALFVDANNVSSK
Ga0063103_106885613300021927MarineNKMAVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0063139_105834213300021934MarineKMPAVKKSDKRLKKEAYWGRLQETARKYKNALFVDANNVSSK
Ga0063754_100369713300021937MarineRMPAEVKKSEKRIKKEAYWGRLQETCRKHRNALFVDANNVSSK
Ga0063102_100181313300021941MarineYKMPLEVKKSEKRIKKEAYWKRLQETARTYKNALFVDANNVSSK
Ga0063102_101242413300021941MarineLNKMPAAVKKSDKRIKKEAYWGRLQETARKYKNALFVDANNVSSK
Ga0063102_101469113300021941MarineKMPAEVKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK
Ga0063101_102594813300021950MarineMPAEVKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK
Ga0063101_114602113300021950MarineMAVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0222713_1029893713300021962Estuarine WaterMPVIAASKGAKKSEKRVKKEAFWIRIQRVAQKFKNCLFVDVENVSS
Ga0209631_1022391613300025890Pelagic MarineMTVAKKSDKRVRKEAYWHRLQDVVGKHKNVLFVDVDNVSSKQIG
Ga0209631_1025804713300025890Pelagic MarineMPVAKKSDKRIKKENYWKRLQETARKYKNALFVDANNVSSK
Ga0247594_101617813300026448SeawaterKKSAQRIKKEAYWQRLIDVAGKYNNALFVDSDNVSSK
Ga0247593_102522113300026449SeawaterMPVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK
Ga0247588_102140423300026465SeawaterKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK
Ga0247592_105832143300026500SeawaterVKKSDKRLKKEAYWGRLQDTARKYKNALFVDANNVSSN
Ga0247592_113602523300026500SeawaterSHSIMPGVKKSEKRIKKEAYWKRLQVTARKYKNCLFVDANNVSSK
Ga0247590_105643013300026513SeawaterKMPGVKKSEKRIKKEAYWKRLQVTARKYKNCLFVDANNVSSK
Ga0209092_1043846313300027833MarineMPAEVKKSEKRIKKEAYWGRLQETCRKHRNALFVDANNVSSK
Ga0209712_1012686323300027849MarineMPAAVKKSDKRIKKEAYWGRLQETARKYKNALFVDANNVSSK
Ga0247582_104524113300028109SeawaterIQMPVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK
Ga0247584_104162513300028110SeawaterTIQMPVAKKSEKRIKKEAYWKRLQITARKYKNCMFVDANNVSSK
Ga0256412_109910613300028137SeawaterKMPAVKKTAKRIKKENYWRRIQQVAYKYNNVLFVNADNVSSK
Ga0256412_139390013300028137SeawaterMSAVNKSEKRLKKESRWRRVQEIAYKYNNVLFVDANNVSSN
Ga0256413_107533923300028282SeawaterVKKKSAQRIKKEAYWQRLIDVAGKYKNALFVDSDNVSSK
Ga0304731_1011563533300028575MarineKVRMAVKKKSEKRIKKEAYWTRLQQVAQKYRNVLFVNADNVSSL
Ga0307402_1020060713300030653MarineYQLKMPKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK
Ga0307403_1016545413300030671MarineMPAAKKSDKRIKKEAYWGRLQETARKYKNALFVDANNVSSK
Ga0307403_1070373723300030671MarineMAVKKKSEKRIKKEAYWFRLQDVAQKYNNVMFVDANNVSSK
Ga0307399_1009161613300030702MarineMAVKKKSDKRIKKEAYWVRLQQVAMKYRNVLFVNADNVSSL
Ga0307400_1082212713300030709MarineMPKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK
Ga0308129_100757213300030723MarineKMAVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0308128_100975123300030725MarineAVKKKSDKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0073981_1097466423300030857MarineKKSEKRIRKEANWHKVQDAVEKYKNCLFVDADNVSSK
Ga0308143_10673313300031540MarineKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK
Ga0308144_101105213300031570MarineNKMPAEVKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK
Ga0308132_102991443300031580MarineKKSEKRIKKEAYWFRLQEVAQKYRNVLFVNADNVSSL
Ga0308132_105201213300031580MarineKMPQAVKKSEKRIKKEAYWKRLQETARTYKNALFVDANNVSSK
Ga0302126_1007842423300031622MarineVKKSDKRIKKEAYWGRLQETCRKYRNALFVDANNVSSK
Ga0307393_102611613300031674MarineKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK
Ga0307393_102937213300031674MarineILKMVVKKKSEKRVKKENYWDRIQEVAVKYKNVLFINSDNVSSLQICKLR
Ga0307393_103410043300031674MarineFRMAVKKKSDKRIKKEAYWVRLQQVAMKYRNVLFVNADNVSSL
Ga0307385_1009929613300031709MarineQMPAVKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK
Ga0307386_1013664213300031710MarineKQMPAVKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK
Ga0307386_1013918143300031710MarineYYLSFRMAVKKKSDKRIKKEAYWVRLQQVAMKYRNVLFVNADNVSSL
Ga0307386_1027217113300031710MarineKKSDRRVKKENYWNRLIMVAYKYKNVLFVNADNVSSLQICKLR
Ga0307386_1066272013300031710MarineNMPAAKKSEKRVKKEAYWKRLQETARKYKNALFVDANNVSSK
Ga0307396_1024530013300031717MarineLSFRMAVKKKSDKRIKKEAYWVRLQQVAMKYRNVLFVNADNVSSL
Ga0307381_1006326613300031725MarineRMPVKKKSEKRIKKENYWDRIQEVAYKYKNVLFINPDNVSSLQICKLR
Ga0307381_1006853113300031725MarineLNKPAQKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK
Ga0307381_1008401113300031725MarineQMPAVKKSEKRLKKEAYWKRLQETARKYKNALFVDANNVSSK
Ga0307381_1020350043300031725MarineSILKMVVKKKSDRRVKKENYWNRLIMVAYKYKNVLFVNADNVSSLQICKLR
Ga0307391_1018415813300031729MarineKRMPKIVKSDKRIKKEKYWGRLQHIVANYKNAAFIDANNVSSK
Ga0307391_1083343223300031729MarineLKMVVKKKSEKRVKKENYWDRIQEVAVKYKNVLFINSDNVSSLQICKLR
Ga0307397_1018086313300031734MarinePKIVKSDKRIKKEKYWGRLQHIVANYKNAAFIDANNVSSK
Ga0307394_1008781113300031735MarineYILKMVVKKKSEKRVKKENYWDRIQEVAVKYKNVLFINSDNVSSLQICKLR
Ga0307394_1011916533300031735MarineMPAAKKSEKRIKKEAYWRRLQETARKYKNALIVDANNVSSK
Ga0307384_1012226113300031738MarineILKMVVKKKSDRRVKKENYWNRLIMVAYKYKNVLFVNADNVSSL
Ga0307384_1013197413300031738MarineMPVAKKSDKRVKKEAYWKRLVYTAETYKNVMFVNANNVSSK
Ga0307384_1016849813300031738MarineMPAAKKSEKRVKKEAYWKRLQETARKYKNALFVDANNVSSK
Ga0307383_1012572713300031739MarineVKLNMPAQKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK
Ga0307383_1012582013300031739MarineMPAVKKSEKRLKKEAYWKRLQETARKYKNALFVDANNVSSK
Ga0307383_1013145443300031739MarineMPVKKKSEKRIKKEAHWVKIQEAAEKYKNCLFVDADNVSSK
Ga0307383_1014229143300031739MarineLKMVVKKKSDRRVKKENYWNRLIMVAYKYKNVLFVNADNVSSLQICKLR
Ga0307395_1040439313300031742MarineTKGEKKSEKRIKKEAYWKRLQETARKYNNALFVDANNVSSK
Ga0307382_1010956213300031743MarineLNMPAQKKSEKRIKKEAYWKRLQETARKYKNALFVDANNVSSK
Ga0307382_1016535863300031743MarineVKKKSDRRVKKENYWNRLIMVAYKYKNVLFVNADNVSSLQICKLR
Ga0307404_1009564813300031752MarineMAIKKKSDKRVKKENYYVRLQEVAAKYKNCLFVNADNVSSL
Ga0314675_1012300413300032491SeawaterKETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0314679_1009524713300032492SeawaterLFKIPIYFIIEYIKETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0314688_1013614813300032517SeawaterNKMAVKKKSDKRIKKEAYWFRLQDAAAKYNNVMFVDANNVSSK
Ga0314688_1015944013300032517SeawaterKMPAEKKSEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK
Ga0314676_1017297713300032519SeawaterETNKMAVKKKSDKRIKKEAYWFRLQDAAAKYNNVMFVDANNVSSK
Ga0314673_1012387913300032650SeawaterPAEKKSEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK
Ga0314685_1021110213300032651SeawaterMPAEKKSEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK
Ga0314669_1011313713300032708SeawaterLFKIPFYFIIEYIKETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0314672_106918813300032709SeawaterIKETNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0314702_138725713300032725SeawaterTNKMAVKKKSEKRIKKEAYWFRLQDVAAKYNNVMFVDANNVSSK
Ga0314699_1011421933300032730SeawaterEKKSEKRIKKEAYWRRLQETARKYNNALFVDANNVSSK
Ga0314709_1021128813300032755SeawaterKETNKMAVKKKSDKRIKKEAYWFRLQDAAAKYNNVMFVDANNVSSK
Ga0307390_1020115213300033572MarineFKRMAIKKKSDKRVKKENYYVRLQEVAAKYKNCLFVNADNVSSL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.