Scaffold Ga0193572_104336

Overview

Basic Information

• Taxon OID: 3300018573
• Scaffold ID: Ga0193572_104336
• Source Dataset Name: Metatranscriptome of marine microbial communities from upper halo cline of Thetis Basin, Eastern Mediterranean Sea - 18_2
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Woods Hole Oceanographic Institution
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1077
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea

Source Dataset Sampling Location

• Location Name: Eastern Mediterranean Sea
• Coordinates
  • Lat. (^o): 34.4
  • Long. (^o): 22.08
  • Depth (m): 3259

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020197	Metagenome / Metatranscriptome	225	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193572_1043363	F020197	AGGA	MEYNKPFSKGFVLRTTAKHMRKSIDISIRKTFERMEEFADTEKSTEVLTTLSVLHIMRKWLDDF