3300018573: Metatranscriptome of marine microbial communities from upper halo cline of Thetis Basin, Eastern Mediterranean Sea - 18_2

Overview

Basic Information

• IMG/M Taxon OID: 3300018573
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0129121 | Gp0217192 | Ga0193572
• Sample Name: Metatranscriptome of marine microbial communities from upper halo cline of Thetis Basin, Eastern Mediterranean Sea - 18_2
• Sequencing Status: Permanent Draft
• Sequencing Center: Woods Hole Oceanographic Institution
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 29899903
• Sequencing Scaffolds: 2
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Metatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine benthic biome → marine benthic feature → hypersaline water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Eastern Mediterranean Sea
• Coordinates
  • Lat. (^o): 34.4
  • Long. (^o): 22.08
  • Alt. (m): N/A
  • Depth (m): 3259

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000155	Metagenome / Metatranscriptome	1877	Y
F000481	Metagenome / Metatranscriptome	1089	Y
F020197	Metagenome / Metatranscriptome	225	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0193572_104336	All Organisms → Viruses → Predicted Viral	1077
Ga0193572_115668	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis	514

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0193572_104336	Ga0193572_1043363	F020197	MEYNKPFSKGFVLRTTAKHMRKSIDISIRKTFERMEEFADTEKSTEVLTTLSVLHIMRKWLDDF
Ga0193572_115668	Ga0193572_1156681	F000481	RAKDQRKDEFDKLENIIKKHEELIPTVMKTQVMVDLYWKCYAYGDELKPHIEFLDGIMLSSTRDIAPSCVESVDELIERQEKSLVQLETKRGVVKELIEKGKIILQNPDKPKFLESHVKRIEDGWDDTKDKASARLKLLTETKDAWVGYAENSETIAVEFDKGEEEIKKVK
Ga0193572_116002	Ga0193572_1160021	F000155	MKFALALAVVSATKYDHMNEDELLVNLSSTLSSALESEARGDGDAAVAKTAAIKNIQKSLTARILKRLDDGQPLVEVARKMKAIEGMQP