| Basic Information | |
|---|---|
| Taxon OID | 3300018570 Open in IMG/M |
| Scaffold ID | Ga0193573_103322 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine microbial communities from upper halo cline of Thetis Basin, Eastern Mediterranean Sea - 18_4 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Woods Hole Oceanographic Institution |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 740 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Eastern Mediterranean Sea | |||||||
| Coordinates | Lat. (o) | 34.4 | Long. (o) | 22.08 | Alt. (m) | Depth (m) | 3259 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037503 | Metagenome / Metatranscriptome | 168 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193573_1033221 | F037503 | N/A | MYLGTALRSSVIEVELLIGLGGFTAYQTLTNSECYNIYSRVRAWVLRSMSERERTQTIS |
| ⦗Top⦘ |