| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300018570 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0129121 | Gp0217193 | Ga0193573 |
| Sample Name | Metatranscriptome of marine microbial communities from upper halo cline of Thetis Basin, Eastern Mediterranean Sea - 18_4 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Woods Hole Oceanographic Institution |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 20433191 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Metatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Upper And Lower Halo Cline Of Thetis Basin, Eastern Mediterranean Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine benthic biome → marine benthic feature → hypersaline water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Eastern Mediterranean Sea | |||||||
| Coordinates | Lat. (o) | 34.4 | Long. (o) | 22.08 | Alt. (m) | N/A | Depth (m) | 3259 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037503 | Metagenome / Metatranscriptome | 168 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0193573_103322 | Not Available | 740 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0193573_103322 | Ga0193573_1033221 | F037503 | MYLGTALRSSVIEVELLIGLGGFTAYQTLTNSECYNIYSRVRAWVLRSMSERERTQTIS |
| ⦗Top⦘ |