Scaffold Ga0190274_10298479

Overview

Basic Information

• Taxon OID: 3300018476
• Scaffold ID: Ga0190274_10298479
• Source Dataset Name: Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1497
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location

• Location Name: USA: Montana
• Coordinates
  • Lat. (^o): 45.6356
  • Long. (^o): -110.571

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023886	Metagenome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190274_102984793	F023886	GAG	MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYGEYAK