Basic Information | |
---|---|
Family ID | F023886 |
Family Type | Metagenome |
Number of Sequences | 208 |
Average Sequence Length | 46 residues |
Representative Sequence | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAY |
Number of Associated Samples | 162 |
Number of Associated Scaffolds | 208 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 84.62 % |
% of genes near scaffold ends (potentially truncated) | 97.60 % |
% of genes from short scaffolds (< 2000 bps) | 94.23 % |
Associated GOLD sequencing projects | 150 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.385 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (8.654 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (67.788 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 208 Family Scaffolds |
---|---|---|
PF01380 | SIS | 52.88 |
PF03331 | LpxC | 7.69 |
PF12849 | PBP_like_2 | 3.37 |
PF13531 | SBP_bac_11 | 2.40 |
PF13847 | Methyltransf_31 | 1.44 |
PF05635 | 23S_rRNA_IVP | 0.96 |
PF00300 | His_Phos_1 | 0.48 |
PF11050 | Viral_env_E26 | 0.48 |
PF13414 | TPR_11 | 0.48 |
PF00656 | Peptidase_C14 | 0.48 |
PF00378 | ECH_1 | 0.48 |
PF12848 | ABC_tran_Xtn | 0.48 |
PF09335 | SNARE_assoc | 0.48 |
PF13620 | CarboxypepD_reg | 0.48 |
PF00486 | Trans_reg_C | 0.48 |
PF05899 | Cupin_3 | 0.48 |
PF05977 | MFS_3 | 0.48 |
PF00571 | CBS | 0.48 |
PF00072 | Response_reg | 0.48 |
COG ID | Name | Functional Category | % Frequency in 208 Family Scaffolds |
---|---|---|---|
COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 7.69 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.48 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.48 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.48 |
COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.48 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.38 % |
Unclassified | root | N/A | 9.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig1345063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 539 | Open in IMG/M |
2162886007|SwRhRL2b_contig_759100 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
2199352025|deepsgr__Contig_58215 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
3300000956|JGI10216J12902_118614501 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300001432|JGI24034J14986_100124 | All Organisms → cellular organisms → Bacteria | 3553 | Open in IMG/M |
3300002914|JGI25617J43924_10355724 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300003319|soilL2_10024508 | All Organisms → cellular organisms → Bacteria | 4148 | Open in IMG/M |
3300003993|Ga0055468_10168906 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300004156|Ga0062589_102021451 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300004463|Ga0063356_106089788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300004643|Ga0062591_100829830 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300004778|Ga0062383_10011725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2910 | Open in IMG/M |
3300005093|Ga0062594_101182855 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300005093|Ga0062594_102105283 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300005289|Ga0065704_10780859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300005294|Ga0065705_10675954 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300005294|Ga0065705_10998938 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005295|Ga0065707_10375090 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300005331|Ga0070670_100420929 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300005338|Ga0068868_101146728 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300005338|Ga0068868_101291517 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300005343|Ga0070687_100815503 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300005345|Ga0070692_10130278 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300005345|Ga0070692_10892775 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300005347|Ga0070668_100988799 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300005364|Ga0070673_100603449 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300005365|Ga0070688_100912008 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300005367|Ga0070667_101080571 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300005444|Ga0070694_100353975 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300005445|Ga0070708_100151530 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
3300005445|Ga0070708_101710999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300005518|Ga0070699_102205215 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005530|Ga0070679_101823157 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300005536|Ga0070697_100510201 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300005546|Ga0070696_100210220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1456 | Open in IMG/M |
3300005546|Ga0070696_100621369 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300005549|Ga0070704_101416870 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300005554|Ga0066661_10378578 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300005577|Ga0068857_100653050 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300005577|Ga0068857_101368840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 688 | Open in IMG/M |
3300005578|Ga0068854_101303747 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300005578|Ga0068854_101640790 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300005578|Ga0068854_101661521 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300005615|Ga0070702_100260290 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300005615|Ga0070702_101030527 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300005615|Ga0070702_101598425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300005616|Ga0068852_101326990 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300005617|Ga0068859_100750690 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300005618|Ga0068864_102679399 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300005719|Ga0068861_100022462 | All Organisms → cellular organisms → Bacteria | 4546 | Open in IMG/M |
3300005840|Ga0068870_10087514 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
3300005842|Ga0068858_100583685 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300005842|Ga0068858_101315549 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300005842|Ga0068858_101644619 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300005843|Ga0068860_101273226 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300005843|Ga0068860_101728440 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300005843|Ga0068860_102319510 | Not Available | 557 | Open in IMG/M |
3300005879|Ga0075295_1040216 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300005983|Ga0081540_1173511 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300006034|Ga0066656_10537660 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300006049|Ga0075417_10685118 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300006058|Ga0075432_10419485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 581 | Open in IMG/M |
3300006237|Ga0097621_101045569 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300006755|Ga0079222_11004999 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300006755|Ga0079222_12490471 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300006796|Ga0066665_11700102 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300006797|Ga0066659_11045429 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300006903|Ga0075426_10057813 | All Organisms → cellular organisms → Bacteria | 2768 | Open in IMG/M |
3300006904|Ga0075424_100982246 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300006931|Ga0097620_100843323 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300009093|Ga0105240_11346408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 752 | Open in IMG/M |
3300009098|Ga0105245_12166636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 610 | Open in IMG/M |
3300009101|Ga0105247_10234319 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300009101|Ga0105247_10494713 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300009137|Ga0066709_103839656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 546 | Open in IMG/M |
3300009143|Ga0099792_10416462 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300009147|Ga0114129_11487021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300009147|Ga0114129_13114667 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300009148|Ga0105243_11742357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 653 | Open in IMG/M |
3300009156|Ga0111538_10183407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2657 | Open in IMG/M |
3300009176|Ga0105242_13084322 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300009177|Ga0105248_11427977 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300009553|Ga0105249_12703107 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300009553|Ga0105249_13371965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300009789|Ga0126307_11157695 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300010040|Ga0126308_10702563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
3300010044|Ga0126310_10631887 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300010359|Ga0126376_12344145 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300010361|Ga0126378_13456630 | Not Available | 501 | Open in IMG/M |
3300010373|Ga0134128_12806363 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300010396|Ga0134126_12454620 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300010397|Ga0134124_10635876 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300010397|Ga0134124_12222158 | Not Available | 588 | Open in IMG/M |
3300010399|Ga0134127_11649470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300010399|Ga0134127_12657248 | Not Available | 580 | Open in IMG/M |
3300010399|Ga0134127_13058914 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300010399|Ga0134127_13591199 | Not Available | 509 | Open in IMG/M |
3300010400|Ga0134122_11421215 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300010400|Ga0134122_11897811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300010400|Ga0134122_12103589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300010400|Ga0134122_12893498 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010401|Ga0134121_12490608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 559 | Open in IMG/M |
3300010403|Ga0134123_10088327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2435 | Open in IMG/M |
3300010403|Ga0134123_12432892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300011119|Ga0105246_11236772 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300011119|Ga0105246_12026624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 556 | Open in IMG/M |
3300011119|Ga0105246_12335290 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300011271|Ga0137393_11714388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300011431|Ga0137438_1090120 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300012198|Ga0137364_10156262 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
3300012203|Ga0137399_11248021 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300012203|Ga0137399_11516528 | Not Available | 558 | Open in IMG/M |
3300012353|Ga0137367_10481231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
3300012355|Ga0137369_11161521 | Not Available | 500 | Open in IMG/M |
3300012359|Ga0137385_11230288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
3300012360|Ga0137375_10568805 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 950 | Open in IMG/M |
3300012509|Ga0157334_1027177 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300012515|Ga0157338_1004212 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300012532|Ga0137373_11318857 | Not Available | 501 | Open in IMG/M |
3300012582|Ga0137358_10753252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 650 | Open in IMG/M |
3300012685|Ga0137397_10599044 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300012685|Ga0137397_11321807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300012883|Ga0157281_1010030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
3300012903|Ga0157289_10280996 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300012925|Ga0137419_10022129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3736 | Open in IMG/M |
3300012930|Ga0137407_12244522 | Not Available | 522 | Open in IMG/M |
3300012944|Ga0137410_10669563 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300012948|Ga0126375_10229229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
3300012984|Ga0164309_10808719 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300013102|Ga0157371_10429613 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300013102|Ga0157371_10512286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
3300013102|Ga0157371_11245745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 574 | Open in IMG/M |
3300013296|Ga0157374_11599964 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300013297|Ga0157378_11225621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
3300013297|Ga0157378_11550938 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300013306|Ga0163162_11603968 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300013307|Ga0157372_11577837 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300013308|Ga0157375_12882666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 575 | Open in IMG/M |
3300013754|Ga0120183_1003212 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300013760|Ga0120188_1006938 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300014325|Ga0163163_13133696 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300014326|Ga0157380_10716787 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300014326|Ga0157380_13331478 | Not Available | 514 | Open in IMG/M |
3300015241|Ga0137418_10558755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
3300015371|Ga0132258_11895805 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300015371|Ga0132258_12348717 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
3300015372|Ga0132256_101436467 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300015372|Ga0132256_103491605 | Not Available | 528 | Open in IMG/M |
3300015373|Ga0132257_103088253 | Not Available | 606 | Open in IMG/M |
3300015374|Ga0132255_100816251 | Not Available | 1391 | Open in IMG/M |
3300017789|Ga0136617_11403270 | Not Available | 521 | Open in IMG/M |
3300018076|Ga0184609_10349283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 690 | Open in IMG/M |
3300018432|Ga0190275_13299441 | Not Available | 522 | Open in IMG/M |
3300018466|Ga0190268_10555123 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300018476|Ga0190274_10298479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1497 | Open in IMG/M |
3300018476|Ga0190274_13134782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300018476|Ga0190274_13275213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 545 | Open in IMG/M |
3300020018|Ga0193721_1145246 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300021445|Ga0182009_10117986 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300021445|Ga0182009_10658195 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300022737|Ga0247747_1031986 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300024325|Ga0247678_1078186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300025321|Ga0207656_10682757 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300025322|Ga0209641_10034968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3904 | Open in IMG/M |
3300025327|Ga0209751_11188689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300025903|Ga0207680_10337627 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300025917|Ga0207660_10526940 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300025933|Ga0207706_10619898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
3300025933|Ga0207706_10862575 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300025934|Ga0207686_10178901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1502 | Open in IMG/M |
3300025934|Ga0207686_11808445 | Not Available | 506 | Open in IMG/M |
3300025936|Ga0207670_11087814 | Not Available | 675 | Open in IMG/M |
3300025938|Ga0207704_10214487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1419 | Open in IMG/M |
3300025940|Ga0207691_11353088 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300025942|Ga0207689_10896896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
3300025944|Ga0207661_11381015 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300025945|Ga0207679_10516256 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300025960|Ga0207651_11123520 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300025981|Ga0207640_10371805 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300026023|Ga0207677_10587005 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300026075|Ga0207708_10769442 | Not Available | 827 | Open in IMG/M |
3300026078|Ga0207702_11691568 | Not Available | 626 | Open in IMG/M |
3300026088|Ga0207641_11533210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
3300026089|Ga0207648_10432087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
3300026089|Ga0207648_11108173 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300026095|Ga0207676_10487948 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300026095|Ga0207676_12164563 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300026116|Ga0207674_10645951 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300026116|Ga0207674_11582793 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300026323|Ga0209472_1282460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300027326|Ga0209731_1053650 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300027639|Ga0209387_1032751 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300027639|Ga0209387_1078002 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300027882|Ga0209590_10811668 | Not Available | 594 | Open in IMG/M |
3300027907|Ga0207428_10419875 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300027909|Ga0209382_10886940 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300028379|Ga0268266_11909479 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300028381|Ga0268264_10643391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
3300031164|Ga0307502_10040339 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300031548|Ga0307408_100058852 | All Organisms → cellular organisms → Bacteria | 2795 | Open in IMG/M |
3300031731|Ga0307405_10233245 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
3300031908|Ga0310900_10208746 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
3300031949|Ga0214473_12390466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 504 | Open in IMG/M |
3300032005|Ga0307411_11196591 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300032012|Ga0310902_10486948 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300033412|Ga0310810_10958953 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300033475|Ga0310811_11145434 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300033480|Ga0316620_10083968 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.65% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 7.21% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.25% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.29% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.44% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.44% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.44% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.44% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.44% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.44% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.48% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.48% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.48% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.48% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.48% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.48% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.48% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.48% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.48% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.48% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.48% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013754 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2 | Environmental | Open in IMG/M |
3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031164 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 16_S | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_05510080 | 2124908045 | Soil | MGILNLLPKEEQYFDLFKQMTLYIVDAARELKQMLADKQP |
SwRhRL2b_0126.00001050 | 2162886007 | Switchgrass Rhizosphere | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLADKNHDYAEYAQRIK |
deepsgr_00706520 | 2199352025 | Soil | MSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLSDKNRDYAEYAHE |
JGI10216J12902_1186145012 | 3300000956 | Soil | MAFLNLLPKEEQYFDLFNQMTVYISDAARELRDMLADKDHDYSGYAQRIK |
JGI24034J14986_1001246 | 3300001432 | Corn, Switchgrass And Miscanthus Rhizosphere | MGILNLLPKEEQYFDLFVQMTLYIGDAARELKQMLSDERQNYGE |
JGI25617J43924_103557242 | 3300002914 | Grasslands Soil | MGILNLLPKEEQYFDLFIQMTVYISAAARELKEMLADKNRAF |
soilL2_100245082 | 3300003319 | Sugarcane Root And Bulk Soil | MGLSLLPKEEQYFDLFAQMTLYISSAARELKEMMADKHADYREYAQR |
Ga0055468_101689062 | 3300003993 | Natural And Restored Wetlands | MGLLSLLPKEDQYFDLFTQMTLYISAAARELKEMLADKDRDYGE |
Ga0062589_1020214512 | 3300004156 | Soil | MGWSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNGNYGEYAK |
Ga0063356_1060897881 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MGLLNFLPKEEQYFDLFLQMTVYISDAARELKEMLADKTGDYVEYAKRIKGM |
Ga0062591_1008298301 | 3300004643 | Soil | MGLLNLLPREEQYFSLFIQMTVYIADAARELKEMLADKNRDY |
Ga0062383_100117251 | 3300004778 | Wetland Sediment | MGFFNFLPKEEQYFDLFAQMTVYISDAARALSEMLSDKDADFE |
Ga0062594_1011828552 | 3300005093 | Soil | MGLLSLLPKEDQYFDLFTQMTLYISSAARELKEMLADKNHDYAEYAQ |
Ga0062594_1021052832 | 3300005093 | Soil | MGLLNLLPKEDQYFDLFTQMTLYISAAARELKEMLADKNHDYGEYAQ |
Ga0065704_107808592 | 3300005289 | Switchgrass Rhizosphere | MGLLNFLPKEEQYFDLFLQMTLYICDAARELKGMLADKNHNYQDY |
Ga0065705_106759541 | 3300005294 | Switchgrass Rhizosphere | MGLINLLPKEDQYFDLFTQMTLYISSAARELKEMLADRNHAYGEYAKRIKGLEH |
Ga0065705_109989381 | 3300005294 | Switchgrass Rhizosphere | MGSISLLPREDQYFDLFTQMTLYISSAARELKEMMADKNRQYGEYAQ |
Ga0065707_103750901 | 3300005295 | Switchgrass Rhizosphere | MSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLADKNG |
Ga0070670_1004209292 | 3300005331 | Switchgrass Rhizosphere | MGLLSLLPKEDQYFDLFTQMTLYISSAARELKEMMADKNHD |
Ga0068868_1011467281 | 3300005338 | Miscanthus Rhizosphere | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLADKNHDYAEYAQRIKGLE |
Ga0068868_1012915172 | 3300005338 | Miscanthus Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYGEYAKRIKGL |
Ga0070687_1008155031 | 3300005343 | Switchgrass Rhizosphere | MGLLSLLPKEDQYFDLFTQMTLYISSAARELKEMLADKNH |
Ga0070692_101302781 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLLSFLPKEDQYFDLFTQMTLYISAAARELKEMLADKNHDYGEYAQRIKGLE |
Ga0070692_108927752 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFLNLLPKEEQYFDLFTQMTLYISAAARELKEMLSDKNRDYAEYAQR |
Ga0070668_1009887992 | 3300005347 | Switchgrass Rhizosphere | MGLLNLLPREEQYFSLFIQMTVYISDAARELKEMLADKNRDYGEYAQRIKGLEHAC |
Ga0070673_1006034492 | 3300005364 | Switchgrass Rhizosphere | MGLLNFLPREEQYFDLFAQMTLYISSAARELKEMLADKNHDFAEYAQRIKGLEHACDELPTIFRRS* |
Ga0070688_1009120082 | 3300005365 | Switchgrass Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYGEYAKRIKGLEHACDE |
Ga0070667_1010805711 | 3300005367 | Switchgrass Rhizosphere | MSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLSDKNRDYAEYAQRIKGL |
Ga0070694_1003539752 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MGILNFLPREEQYFDLFIQMTVYISSAARELKEMLADKNRDYESYAQRIKGLEHA |
Ga0070708_1001515302 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLLNFLPKEEQYFDLFVQMTLYICDAARELKGMLADRNHNYQEYS |
Ga0070708_1017109991 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLLNFLPKEEQYFDLFLQMTLYICDAARELKDMLADKDHNYQEYSRRIKGLEHACD |
Ga0070699_1022052152 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLADKNHDYAEYA |
Ga0070679_1018231572 | 3300005530 | Corn Rhizosphere | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLADKNR |
Ga0070697_1005102012 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VGILNFLPKEEQYFDLFIQMTLYISAAARELKEMLADKNHD |
Ga0070696_1002102203 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLLNFLPKEEQYFALFIQMTVYISDAARELKEMLADKNHDYQVYAQRIKGL |
Ga0070696_1006213691 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFLNLLPKEEQYFDLFNQMTVYISDAARELRDMLSDKNPD |
Ga0070704_1014168702 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MGILNFLPREEQYFDLFIQMTVYISSAARELKEMLADKNRDYESYAQRIKGL |
Ga0066661_103785781 | 3300005554 | Soil | MGFLNLLPKEEQYFDLFIQMTVYIGDAARELKQMLADKPENYQE |
Ga0068857_1006530501 | 3300005577 | Corn Rhizosphere | MGLISLLPKEDQYFDLFIQMTLYISSAARELKEMLADKNH |
Ga0068857_1013688401 | 3300005577 | Corn Rhizosphere | MGLLNFLPKEEQYFALFIQMTVYISDAARELKEMLSDKNHDYLEYSRRIKG |
Ga0068854_1013037471 | 3300005578 | Corn Rhizosphere | MGLLSFLPKEDQYFDLFTQMTLYISAAARELKEMLA |
Ga0068854_1016407902 | 3300005578 | Corn Rhizosphere | MGFISLLPREDQYFDLFTQMTLYISAAARELKEMLADK |
Ga0068854_1016615212 | 3300005578 | Corn Rhizosphere | MSFLNLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHDYAEYAQRIKGL |
Ga0070702_1002602901 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLLNFLPREEQYFDLFAQMTLYISSAARELKEMLADKNHDFAEYAQRIKGLEHACDELT |
Ga0070702_1010305271 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLSLLPKEDQYFDLFTQMTLYISSAARELKEMLSDKHGD |
Ga0070702_1015984252 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLLNLLPREEQYFSLFIQMTVYISDAARELKEMLADKNRDYGEYAQRIKGL |
Ga0068852_1013269901 | 3300005616 | Corn Rhizosphere | MGLLNLLPKEDQYFDLFTQMTLYISAAARELKEMLADKNH |
Ga0068859_1007506902 | 3300005617 | Switchgrass Rhizosphere | MGFLNLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNR |
Ga0068864_1026793992 | 3300005618 | Switchgrass Rhizosphere | MGFLNFLPKEDQYFDLFNQMTVYISDAARELRDMLSDKNPD |
Ga0068861_1000224621 | 3300005719 | Switchgrass Rhizosphere | MGLISLLPREDQYFDLFTQMTLYISEAARELKEMLADKNHDYGEYAQR |
Ga0068870_100875141 | 3300005840 | Miscanthus Rhizosphere | MSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLADKNGNYAEYAQRIKGLEHACDEL |
Ga0068858_1005836852 | 3300005842 | Switchgrass Rhizosphere | MGFLSLLPKEEQYFDLFNQMTVYISDAARELQDMLSDKNPDFAGYAQRIKGLEH |
Ga0068858_1013155491 | 3300005842 | Switchgrass Rhizosphere | MGFLNFLPKEEQYFDLFTQMTLYISAAARELKEMLADKNQAYGEYAQRIKGL |
Ga0068858_1016446191 | 3300005842 | Switchgrass Rhizosphere | MGLISLLPKEDQYFDLFTQMTLYISAAARELKEMLADKNH |
Ga0068860_1012732261 | 3300005843 | Switchgrass Rhizosphere | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLADKNHAYGE |
Ga0068860_1017284401 | 3300005843 | Switchgrass Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYGEYAKRIKG |
Ga0068860_1023195102 | 3300005843 | Switchgrass Rhizosphere | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLAD |
Ga0075295_10402161 | 3300005879 | Rice Paddy Soil | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEML |
Ga0081540_11735112 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MGFLNLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNQDFGE |
Ga0066656_105376602 | 3300006034 | Soil | MGLLNLLPKEEQYFDLFIQMTLYISEAARELKQMLAD |
Ga0075417_106851182 | 3300006049 | Populus Rhizosphere | MGLISLLPKEDQYFDLFTQMTLYISSAARELKEMLADKNHDYGEYAQRI |
Ga0075432_104194852 | 3300006058 | Populus Rhizosphere | MGLLNLIPREEQYFDLFIQMTVYIGDAARELRAMLKDNRESY |
Ga0097621_1010455692 | 3300006237 | Miscanthus Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLAD |
Ga0079222_110049992 | 3300006755 | Agricultural Soil | MGLISLLPKEDQYFDLYTQMTLYISAAARELKEMLAD |
Ga0079222_124904712 | 3300006755 | Agricultural Soil | MGLISLLPKEDQYFDLFTQMTLYISAAARELKEMLADKNHAYGEY |
Ga0066665_117001021 | 3300006796 | Soil | MGLLNLLPREEQYFDLFVQMTVYISEAARELKQMLADKEHNY |
Ga0066659_110454292 | 3300006797 | Soil | MGLLNFLPKEEQYFDLFTQMTLYISDAARTLVEMLS |
Ga0075426_100578131 | 3300006903 | Populus Rhizosphere | MGSISLLPREDQYFDLFTQMTLYISAAARELKEMLADKNQAYADY |
Ga0075424_1009822462 | 3300006904 | Populus Rhizosphere | MGLLNLLPKEEQYFDLFSQMTLYISSAARELKEMLADKNHDYTE |
Ga0097620_1008433231 | 3300006931 | Switchgrass Rhizosphere | MGLISLLPKEDQYFDLFTQMTLYISSAARELKEMLADKNHDYGEYAQRIKGL |
Ga0105240_113464081 | 3300009093 | Corn Rhizosphere | MGFLSLLPKEEQYFDLFNQMTVYISDAARELQDMLSDKNP |
Ga0105245_121666362 | 3300009098 | Miscanthus Rhizosphere | MSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLSDKNRDYAEYAQRIKGLEHACDE |
Ga0105247_102343192 | 3300009101 | Switchgrass Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHA |
Ga0105247_104947132 | 3300009101 | Switchgrass Rhizosphere | MGLLSLLPKEDQYFDLFTQMTLYISSAARELKEMLADKNHAYAEYAK |
Ga0066709_1038396561 | 3300009137 | Grasslands Soil | MGLLNFMPKEEQYFVLFIQMTVYISDAARELKEMLADKNHNYD |
Ga0099792_104164621 | 3300009143 | Vadose Zone Soil | MGLLNLLPKEEQYFDLFIQMTVYISAAARELKEMLADKNRDFAEY |
Ga0114129_114870211 | 3300009147 | Populus Rhizosphere | MGLISLLPKEEQYFDLFTQMTLYISAAARELKEMLADRNHDYGEYAQRIKGLEHAC |
Ga0114129_131146672 | 3300009147 | Populus Rhizosphere | MGLISLLPKEDQYFDLFTQMTLYISSAARELKEMLADRNHAYGEYAKRIK |
Ga0105243_117423571 | 3300009148 | Miscanthus Rhizosphere | MGLLNFLPKEEQYFALFIQMTVYISDAARELKEMLADKDHDYQ |
Ga0111538_101834071 | 3300009156 | Populus Rhizosphere | MGFLNLLPKEEQYFDLFNQMTVYISDAARELRDML |
Ga0105242_130843222 | 3300009176 | Miscanthus Rhizosphere | MSFLNLRPKDDLSSELFAQMTLYISAAARELKEMLAD |
Ga0105248_114279772 | 3300009177 | Switchgrass Rhizosphere | MGLSLLPKEDQYFDLFTQMTLYISSAARELKEMLSDKHG |
Ga0105249_127031071 | 3300009553 | Switchgrass Rhizosphere | MSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLSDKNR |
Ga0105249_133719652 | 3300009553 | Switchgrass Rhizosphere | MGMLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNYGYAEYAKRIKGLEHAC |
Ga0126307_111576951 | 3300009789 | Serpentine Soil | MGLLSFLPKEDQYFDLFTQMTLYISAAARELKEMLADKNRDFAEYAQRIK |
Ga0126308_107025631 | 3300010040 | Serpentine Soil | MGLISLLPKEDQYFDLFTQMTLYISAAARELKEMLSDKKHE |
Ga0126310_106318872 | 3300010044 | Serpentine Soil | MGLLSLLPKEDQYFDLFTQMTLYISAAARELKEML |
Ga0126376_123441452 | 3300010359 | Tropical Forest Soil | MGLISLLPKEDQYFDLFTQMTLYISAAARELKEMLADKNHDYAE* |
Ga0126378_134566301 | 3300010361 | Tropical Forest Soil | MGVLNFLPKDDQYFDLFTQMTLYISDAARTLVEMLSDKN |
Ga0134128_128063631 | 3300010373 | Terrestrial Soil | MGSISLLPREDQYFDLFTQMTLYISEAARELKEMLADKNHDYGEY |
Ga0134126_124546202 | 3300010396 | Terrestrial Soil | MGLFSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYGEYAKRIKGLEHACD |
Ga0134124_106358762 | 3300010397 | Terrestrial Soil | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAY |
Ga0134124_122221582 | 3300010397 | Terrestrial Soil | MGFLSLLPKEEQYFDLFNQMTVYISDAARELQDMLSDKNPDFAGYAQ |
Ga0134127_116494701 | 3300010399 | Terrestrial Soil | MGILNLLPKEEQYFDLFTQMTLYIVEAAGELKQMLADKEQNYKEYSQRIKRLE |
Ga0134127_126572482 | 3300010399 | Terrestrial Soil | MGLLSFLPREEQYFDLFIQMTLYISAAARELKEMLAD |
Ga0134127_130589142 | 3300010399 | Terrestrial Soil | MGMLSLLPKEEQYFDLFTQMTLYISAAARELKEML |
Ga0134127_135911991 | 3300010399 | Terrestrial Soil | MGLLNLLPKEEQYFDLFIQMTVYIVDAAGELKQMLADKDHNYQEYSQRIKRLEH |
Ga0134122_114212151 | 3300010400 | Terrestrial Soil | MGLLSLLPKEDQYFDLFTQMTLYISSAARELKEML |
Ga0134122_118978112 | 3300010400 | Terrestrial Soil | MGILNLLPKEEQYFDLFTQMTLYIVEAAGELKQMLADKEQNYK |
Ga0134122_121035891 | 3300010400 | Terrestrial Soil | MGLLNFLPREEQYFDLFVQMTLYISSAARELKEMLADKNHDYAEYAQRIKGLEHACDEL |
Ga0134122_128934982 | 3300010400 | Terrestrial Soil | MSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLAD |
Ga0134121_124906081 | 3300010401 | Terrestrial Soil | MGLLSLLPKEDQYFDLFTQMTLYISSAARELKEMMADKNHDYGEYAQRI |
Ga0134123_100883273 | 3300010403 | Terrestrial Soil | MGLLNLLPREEQYFSLFIQMTVYISDAARELKEML |
Ga0134123_124328922 | 3300010403 | Terrestrial Soil | MGLLNFLPREEQYFDLFAQMTLYISSAARELKEMLADKNHDFAEYAQRIKGLEHACDEL |
Ga0105246_112367721 | 3300011119 | Miscanthus Rhizosphere | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLADKNHDYAEYAQRIKGLEHACD |
Ga0105246_120266242 | 3300011119 | Miscanthus Rhizosphere | MGAISLLPREDQYFDLFIQMTLYISAAARELKEMLADKNQ |
Ga0105246_123352902 | 3300011119 | Miscanthus Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNQAYGEYAKRIKGL |
Ga0137393_117143881 | 3300011271 | Vadose Zone Soil | MGLLNLLPREEQYFDLFAQMTLYISSAARELKEMLADKNHDYAEYA |
Ga0137438_10901201 | 3300011431 | Soil | MGLLNFLPREEQYFDLFIQMTLYISAAAKELKEMLADKNRDFGEYAQRIKGLEHAC |
Ga0137364_101562623 | 3300012198 | Vadose Zone Soil | MGLLNFLPREEQYFDLFIQMTLYISAAARELKEMLADKNHDFGEYAQRI |
Ga0137399_112480212 | 3300012203 | Vadose Zone Soil | MGLLNLLPREEQYFDLFAQMTLYISSAARELKEMLADKNH |
Ga0137399_115165281 | 3300012203 | Vadose Zone Soil | MGLLNFMPKEEQYFVLFIQMTVYISDAARELKEMLADKNHNYDEYARRIKGLEHA |
Ga0137367_104812311 | 3300012353 | Vadose Zone Soil | MGLLNFLPKEEQYFDLFVQMTLYICDAARELKEMLADKNHNYQEYSQRIKGLEHACDE |
Ga0137369_111615212 | 3300012355 | Vadose Zone Soil | MGILNLIPKEEQYFDLFVQMTVYIGDAARELKQMLADNQEKAAAAEGQP |
Ga0137385_112302881 | 3300012359 | Vadose Zone Soil | MGFFNFLPKEEQYFDLFAQMTLYISDASRTLEEMLTDKTAD |
Ga0137375_105688051 | 3300012360 | Vadose Zone Soil | MGILNLIPKEEQYFDLFVQMTVYIGDAARELKQMLADKPETYKEYSQRIKRLEHACDEL |
Ga0157334_10271771 | 3300012509 | Soil | MSFLNLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHDY |
Ga0157338_10042121 | 3300012515 | Arabidopsis Rhizosphere | MSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLSDKNHDYAEYAQRIKGLEHA |
Ga0137373_113188571 | 3300012532 | Vadose Zone Soil | MGILNFLPKEEQYFDLFIQMTLYISAAARELKEMLADKNH |
Ga0137358_107532521 | 3300012582 | Vadose Zone Soil | MGFFNFLPKEDQYFDLFSQMTLYISAAARELKEMLADKN |
Ga0137397_105990441 | 3300012685 | Vadose Zone Soil | MGLLNFLPREEQYFDLFIQMTLYISSAERELKEMLAEKNHDDAEYAQRIK |
Ga0137397_113218071 | 3300012685 | Vadose Zone Soil | MGLINFLPKEEQYFDLFIQMTVYISDAAGTLTEMLSDKDADYKEDSQRIKGLEHACDE |
Ga0157281_10100301 | 3300012883 | Soil | MGLLNLLPREEQYFSLFIQMTVYISDAARELKEMLADKN |
Ga0157289_102809962 | 3300012903 | Soil | MSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLADKNHNYAEYAQRIKGL |
Ga0137419_100221294 | 3300012925 | Vadose Zone Soil | MGLLNLLPREEQYFDLFAQMTLYISSAARELKEMLADK |
Ga0137407_122445221 | 3300012930 | Vadose Zone Soil | MGFLNFLPKEEQYFDLFAQMTHYISDAARTLVEMLSEKDADFEEY |
Ga0137410_106695631 | 3300012944 | Vadose Zone Soil | MGILNFLPKEDQYFDLFIQMTVYISEASRTLVEMLSDKEPDF |
Ga0126375_102292293 | 3300012948 | Tropical Forest Soil | MGILNLIPKEEQYFDLFTQMTLYISAAARELKEMLVDKNHAFGEYAQRIKDLNTLATS* |
Ga0164309_108087192 | 3300012984 | Soil | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLADKNHDYAEYAQRIKGLEH |
Ga0157371_104296131 | 3300013102 | Corn Rhizosphere | MGFLNFLPKEDQYFDLFTQMTLYISEAARELKEMLADKNHDYGEYAQR |
Ga0157371_105122861 | 3300013102 | Corn Rhizosphere | MGLISLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYGEYAKR |
Ga0157371_112457451 | 3300013102 | Corn Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYGEYAKRIKGLEHAC |
Ga0157374_115999642 | 3300013296 | Miscanthus Rhizosphere | MSFLNLLPKEDQYFDLFTQMTLYISAAARELKEMLADKNQAYGEYAQRIK |
Ga0157378_112256212 | 3300013297 | Miscanthus Rhizosphere | MGLLNLLPREEQYFSLVIQMTVYIADAARELKGMLADKNHNYQEYS |
Ga0157378_115509382 | 3300013297 | Miscanthus Rhizosphere | MSFLNLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHDYGEYAQRIKGLEHACDELT |
Ga0163162_116039681 | 3300013306 | Switchgrass Rhizosphere | MGLLNFLPREEQYFDLFIQMTHYISAAARELKEMLADKNHDYAEYA |
Ga0157372_115778372 | 3300013307 | Corn Rhizosphere | MGLLSLLPKEDQYFDLFTQMTLYISSAARELKEMMADKNHDYAEYAQRIKGV |
Ga0157375_128826661 | 3300013308 | Miscanthus Rhizosphere | MGLLSLLPKEDQYFDLFTQMTLYISSAARELKEMLADKNHDYAEYAQRIKG |
Ga0120183_10032121 | 3300013754 | Terrestrial | MGLLNLLPKEDQYFDLFTQMTLYISAAARELKEMLADKNQAYGE |
Ga0120188_10069381 | 3300013760 | Terrestrial | MGLLSFLPKEDQYFDLFTQMTLYISSAARELKEMLADKDRDYREYAQRIKG |
Ga0163163_131336962 | 3300014325 | Switchgrass Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYITAAARELKEMLADKNHAYAEYAK |
Ga0157380_107167872 | 3300014326 | Switchgrass Rhizosphere | MGLLNFLPREEQYFDLLIQMTLYISAAARELKEMLADKNHDYAEYAQRIKGLEHACDELT |
Ga0157380_133314782 | 3300014326 | Switchgrass Rhizosphere | MSFLNLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHDYGEYAQRIKGL |
Ga0137418_105587552 | 3300015241 | Vadose Zone Soil | MGLLNLLPREEQYFDLFAQMTLYISSAARDLKEMLADKNHDYAEY |
Ga0132258_118958053 | 3300015371 | Arabidopsis Rhizosphere | VEPAEDMSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLSDKN |
Ga0132258_123487172 | 3300015371 | Arabidopsis Rhizosphere | MGLLNFLPKEEQYFDLFSQMTVYISSAARELKEMLADKNHEYGEYAQR |
Ga0132256_1014364671 | 3300015372 | Arabidopsis Rhizosphere | MALFNLLPKEEQYFDLFTQMTLYISAAARELKEMLADKDRNFVEYARRIKGLEHACD |
Ga0132256_1034916051 | 3300015372 | Arabidopsis Rhizosphere | MGILNLIPREEQYFDLFVQMTVYIGDAARELRAMLKDKREN |
Ga0132257_1030882532 | 3300015373 | Arabidopsis Rhizosphere | MGFLSLLPKEEQYFDLFNQMTVYISDAARELQDMLSDK |
Ga0132255_1008162513 | 3300015374 | Arabidopsis Rhizosphere | MGILNLLPKEEQYFDLFVQMTLYIGDAARELRQMLADERQNYSEYSQRIKRLEH |
Ga0136617_114032701 | 3300017789 | Polar Desert Sand | MGLLNFLPKEEQYFTLFIQMTVYISDAARELKEMLADKNHDYPEYVRRIKGLEHA |
Ga0184609_103492832 | 3300018076 | Groundwater Sediment | MGLLNFLPKEEQYFDLFAQMTLYICDAARELNEMLADKNHNYREYSQRIKGLEHAC |
Ga0190275_132994411 | 3300018432 | Soil | MGILNFLPKEEQYFALFIQMTVYISDAARELKEML |
Ga0190268_105551231 | 3300018466 | Soil | MGLLNLLPKEEQYFDLFKQMTLYIVDAARELKQML |
Ga0190274_102984793 | 3300018476 | Soil | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYGEYAK |
Ga0190274_131347821 | 3300018476 | Soil | MGLLSFLPKEEQYFDLFLQMTVYISDAARELKEMLADKNFDY |
Ga0190274_132752131 | 3300018476 | Soil | MGLINLLPKEDLYFDLFTQMTLYISAAARELKEMLADKNQDYDEYAQRIKGLEHACDELT |
Ga0193721_11452462 | 3300020018 | Soil | MGLLNLLPKEEQYFDLFIQMTLYISAAARELKEMLADKNQDFAEYAQRIKG |
Ga0182009_101179862 | 3300021445 | Soil | MGLISLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNF |
Ga0182009_106581951 | 3300021445 | Soil | MGLINLLPKEEQYFDLFTQMTLYISSAARELKEMLADKNHDYG |
Ga0247747_10319862 | 3300022737 | Soil | MSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLADKNHNYAEYA |
Ga0247678_10781861 | 3300024325 | Soil | MGLISLLPREDQYFDLFTQMTLYISSAARELKEMLADKNQ |
Ga0207656_106827572 | 3300025321 | Corn Rhizosphere | MGMLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYAEYAKRIK |
Ga0209641_100349683 | 3300025322 | Soil | MGLLNFLPKEEQYFDLFVQMTLYISSAARELKEMLSDKNHEYHEYAQRIKGLEHACD |
Ga0209751_111886892 | 3300025327 | Soil | MGLLNFLPKEEQYFDLFIQMTLYISSAARELKEMLSDKNHEFHE |
Ga0207680_103376271 | 3300025903 | Switchgrass Rhizosphere | MSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLSDKNRDYAEYAQRIKGLEHACDEL |
Ga0207660_105269401 | 3300025917 | Corn Rhizosphere | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLADKNHD |
Ga0207706_106198981 | 3300025933 | Corn Rhizosphere | MGLLNLLPREEQYFSLFIQMTVYISDAARELKEMLADK |
Ga0207706_108625752 | 3300025933 | Corn Rhizosphere | MGLISLLPKEDQYFDLFTQMTLYISSAARELKEMLADKNHAY |
Ga0207686_101789013 | 3300025934 | Miscanthus Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYGEYAKRIK |
Ga0207686_118084452 | 3300025934 | Miscanthus Rhizosphere | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLADKNH |
Ga0207670_110878141 | 3300025936 | Switchgrass Rhizosphere | MGFLSLLPKEEQYFDLFNQMTVYISDAARELQDMLSDKNPDFAGYA |
Ga0207704_102144872 | 3300025938 | Miscanthus Rhizosphere | MGLINLLPKEDQYFDLFTQMTLYISSAARELKEMLADKN |
Ga0207691_113530881 | 3300025940 | Miscanthus Rhizosphere | MSFLNLLPKEEQYFDLFAQMTLYISAAARELKEMLSDKNRDYAEYAQRIKGLE |
Ga0207689_108968961 | 3300025942 | Miscanthus Rhizosphere | MGLISLLPKEDQYFDLFTQMTLYISSAARELKEMLADKNHDYGEYA |
Ga0207661_113810152 | 3300025944 | Corn Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADK |
Ga0207679_105162562 | 3300025945 | Corn Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNH |
Ga0207651_111235202 | 3300025960 | Switchgrass Rhizosphere | MGLISLLPKEDQYFDLFTQMTLYISSAARELKEMLADKNHAYGEYAKRIK |
Ga0207640_103718052 | 3300025981 | Corn Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYAEYAK |
Ga0207677_105870051 | 3300026023 | Miscanthus Rhizosphere | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLADKNHDYAEYARRIKGLEH |
Ga0207708_107694421 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MGILNLLPKEEQYFDLFTQMTLYIVEAAGELKQMLADKE |
Ga0207702_116915681 | 3300026078 | Corn Rhizosphere | MGLISLLPREDQYFDLFTQMTLYISAAARELKEMLAEKNQVYGEYAKRIK |
Ga0207641_115332102 | 3300026088 | Switchgrass Rhizosphere | MGLISLLPREDQYFDLFTQMTLYISAAARELKEMLAEKNQVYGEYAKRIKGL |
Ga0207648_104320872 | 3300026089 | Miscanthus Rhizosphere | MGLLNLLPREEQYFSLFIQMTVYISDAARELKEMLADKNR |
Ga0207648_111081731 | 3300026089 | Miscanthus Rhizosphere | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLADKNRDYDEYARRIKGL |
Ga0207676_104879481 | 3300026095 | Switchgrass Rhizosphere | MGLINLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAY |
Ga0207676_121645631 | 3300026095 | Switchgrass Rhizosphere | MGLLSLLPKEDQYFDLFTQMTLYISSAARELKEMLADK |
Ga0207674_106459511 | 3300026116 | Corn Rhizosphere | MGLINLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYAEYAKRIKGLEHA |
Ga0207674_115827931 | 3300026116 | Corn Rhizosphere | MGLLSFLPKEDQYFDLFTQMTLYISSAARELKEMLADKNHDY |
Ga0209472_12824602 | 3300026323 | Soil | MGFLNFLPKEEQYFDLFEQMTLYISDAARTLVEMLSDKNADFEEYSRRVKGLEH |
Ga0209731_10536501 | 3300027326 | Forest Soil | MGLLNFLPREEQYFDLFIQMTLYISSAARELKEMLADKNHDYAEYARRIKGL |
Ga0209387_10327513 | 3300027639 | Agricultural Soil | MGLLNFLPKEEQYFDLFLQMTVYISDAARELKEMLADQTGNYVEYAKRI |
Ga0209387_10780021 | 3300027639 | Agricultural Soil | MGLSLLPKEDQYFDLFIQMTLYISSAARELKEMLADKQGDYKEYAQRIKG |
Ga0209590_108116681 | 3300027882 | Vadose Zone Soil | MGLLNFLPREEQYFDLFIQMTLYISAAARELKEMLADKN |
Ga0207428_104198752 | 3300027907 | Populus Rhizosphere | MGLSLLPKEEQYFDLFTQMTLYISSAARELKEMLADKQGDYSEYAQRIKGL |
Ga0209382_108869402 | 3300027909 | Populus Rhizosphere | MGLSLLPKEEQYFDLFTQMTLYISSAARELKEMLSD |
Ga0268266_119094791 | 3300028379 | Switchgrass Rhizosphere | MSFLNLLPKEEQYFDLFIQMTHYISAAARELKEMLADKNHDY |
Ga0268264_106433911 | 3300028381 | Switchgrass Rhizosphere | MGLISLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYGEYAKRIKGL |
Ga0307502_100403392 | 3300031164 | Soil | MGLLNFLPKEEQYFALFIQMTVYISDAARELKEML |
Ga0307408_1000588521 | 3300031548 | Rhizosphere | MGLISLLPKEDQYFDLFTQMTLYISSAARELKEMLADKN |
Ga0307405_102332453 | 3300031731 | Rhizosphere | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYDEYAKRIK |
Ga0310900_102087462 | 3300031908 | Soil | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHAYGEYAKRIKGLE |
Ga0214473_123904662 | 3300031949 | Soil | MGLLNFLPKEEQYFDLFSQMTVYISDAARELKEML |
Ga0307411_111965911 | 3300032005 | Rhizosphere | MGLINLLPREDQYFDLFTQMTLYISAAARELKEMLADKNRDY |
Ga0310902_104869482 | 3300032012 | Soil | MGLSLLPKEDQYFDLFTQMTLYISSAARELKEMLSDKHGDFGEYAQ |
Ga0310810_109589532 | 3300033412 | Soil | MGLINLLPKEDQYFDLFTQMTLYISSAARELKEMLADRNHAYG |
Ga0310811_111454341 | 3300033475 | Soil | MGLLSLLPKEEQYFDLFTQMTLYISAAARELKEMLADKNHDYGEYAQRIKGLEH |
Ga0316620_100839683 | 3300033480 | Soil | MGLLNLLPKEEQYFDLFIQMTLYISAAARELKEMLADKDRNFAEYAQRIK |
⦗Top⦘ |