Scaffold Ga0190272_12102373

Overview

Basic Information

• Taxon OID: 3300018429
• Scaffold ID: Ga0190272_12102373
• Source Dataset Name: Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 602
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.4668
  • Long. (^o): -109.6253

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105531	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0190272_121023732	F105531	N/A	AMPTAADAKVQIYLGFPHYDYQVGPDYRYRDGYGWYRPTGYYNRGRLSCGEARRAVRNNGFRNVATIECNGRTYTFEATRRGRDVTVFVDSRNGRVWRG