Scaffold Ga0187903_11331365

Overview

Basic Information

• Taxon OID: 3300018427
• Scaffold ID: Ga0187903_11331365
• Source Dataset Name: Goat fecal pellet enrichment culture fungal communities from Isla Vista, California, USA - Reed Canary Grass, Gen0, Rep 2, Chloramphenicol
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 505
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Myoviridae sp. ct7Q419 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.4148
  • Long. (^o): -119.8405
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098660	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187903_113313652	F098660	AGGAGG	MQMTMAEKRDLLERIRELTLHDVLTREDRDDIFRVCMVACDRELAKLKKEE