Scaffold Ga0194137_10358417

Overview

Basic Information

• Taxon OID: 3300018411
• Scaffold ID: Ga0194137_10358417
• Source Dataset Name: Freshwater microbial communities from Pennsylvania, USA, analyzing microbe dynamics in response to fracking - TARM_MetaG_T3_14
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 563
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location

• Location Name: USA: Pennsylvania
• Coordinates
  • Lat. (^o): 41.2451
  • Long. (^o): -76.9856

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090615	Metagenome / Metatranscriptome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0194137_103584171	F090615	N/A	RAAPVPAPAQKPTPAASGTLTRSEKLAQMRALQLAAPEPTNPALITALRVRKGWLRPDSSIVDKAAAEGLKKLGVLLCPPPDADKRSATVKQINEVATEYLKAVPQARLLIEESVVEHQASWDPDKVYVERTDADIHEEMVTAIKTANADRLRAAEAKAAAGS