NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184615_10020044

Scaffold Ga0184615_10020044


Overview

Basic Information
Taxon OID3300018059 Open in IMG/M
Scaffold IDGa0184615_10020044 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3680
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075811Metagenome / Metatranscriptome118Y
F096814Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0184615_100200443F096814AGGAGGMKNIGITAIVVGILVIILGLAGVLGQGGNLRSVMVGAVILLVVGFFLYRRGQSGRAM
Ga0184615_100200444F075811GGAGMPKRQVEKRPRDHPLVEFLFAAGAILVIVGFFYAVRRSWPSLDPLSLVMLVGIGLLLVVVCERLRLILQELQELTSLIRTAPADVSEEASK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.