NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184610_1035929

Scaffold Ga0184610_1035929


Overview

Basic Information
Taxon OID3300017997 Open in IMG/M
Scaffold IDGa0184610_1035929 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1413
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005908Metagenome / Metatranscriptome386Y
F049536Metagenome / Metatranscriptome146Y
F057269Metagenome / Metatranscriptome136N

Sequences

Protein IDFamilyRBSSequence
Ga0184610_10359291F057269N/ASTEKIGGLSFIGGTPSFSAKDPNDAYGRLINQLVYNVTYDVRSTWVDQ
Ga0184610_10359293F005908GAGMIKPVLQLAAVGVVGIVLWKVASALLLPLFFVVFKVALIAGLIMLAFWYFNKKGRGKEDTPPASS
Ga0184610_10359294F049536N/AHGELKPENVLLADEGILVVDTGIAAALGKPASARNDMAAVQSLTREMLNGAKPTIADEPLELTRTLPLWLSEWLRSRWSDAGRALAGMRPPPPSTSQSSQLFA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.