| Basic Information | |
|---|---|
| Taxon OID | 3300017923 Open in IMG/M |
| Scaffold ID | Ga0182239_1028346 Open in IMG/M |
| Source Dataset Name | Subsurface microbial communities from deep shales in Texas, USA - hydraulic fracturing test 6_PW_210 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 946 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Texas | |||||||
| Coordinates | Lat. (o) | 30.238 | Long. (o) | -102.628 | Alt. (m) | Depth (m) | 2000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000388 | Metagenome / Metatranscriptome | 1201 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182239_10283461 | F000388 | GGAGG | MKVIKVTKEYFETDNEKVYFFEPLEKEISVEDMQKIVDANEKLVKELEDGTNTVSR |
| ⦗Top⦘ |