NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182238_1034850

Scaffold Ga0182238_1034850


Overview

Basic Information
Taxon OID3300017922 Open in IMG/M
Scaffold IDGa0182238_1034850 Open in IMG/M
Source Dataset NameSubsurface microbial communities from deep shales in Texas, USA - hydraulic fracturing test 6_PW_90
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)641
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Texas
CoordinatesLat. (o)30.238Long. (o)-102.628Alt. (m)Depth (m)2000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094638Metagenome105N

Sequences

Protein IDFamilyRBSSequence
Ga0182238_10348501F094638N/ADNEVVRELTKLSTKMDMVCADISELKTMTRNFLERLTILEERVRSLEDWKDEVTKYDRLKERVKYDFRSAVAGGVAGGLVGVVGSYLIKLMWG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.