Basic Information | |
---|---|
Taxon OID | 3300017919 Open in IMG/M |
Scaffold ID | Ga0182235_100107 Open in IMG/M |
Source Dataset Name | Subsurface microbial communities from deep shales in Ohio, USA - hydraulic fracturing test GB_TM_B |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 28626 |
Total Scaffold Genes | 34 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 29 (85.29%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Ohio | |||||||
Coordinates | Lat. (o) | 40.178 | Long. (o) | -81.073 | Alt. (m) | Depth (m) | 2000 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087432 | Metagenome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0182235_10010726 | F087432 | AGGAGG | MIIYENGEYTPCTYRVTLQNRGVEETHYANFRTHWEDMVAKHDHLTNLNFEQITFSAEQDARLQEISELSIPQGFQAQVREYVENGNFPEGYEHPLSDLKLKKERLQHQNDIDEAYQTILESEGLI |
⦗Top⦘ |