NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182235_100107

Scaffold Ga0182235_100107


Overview

Basic Information
Taxon OID3300017919 Open in IMG/M
Scaffold IDGa0182235_100107 Open in IMG/M
Source Dataset NameSubsurface microbial communities from deep shales in Ohio, USA - hydraulic fracturing test GB_TM_B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)28626
Total Scaffold Genes34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (85.29%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Ohio
CoordinatesLat. (o)40.178Long. (o)-81.073Alt. (m)Depth (m)2000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087432Metagenome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0182235_10010726F087432AGGAGGMIIYENGEYTPCTYRVTLQNRGVEETHYANFRTHWEDMVAKHDHLTNLNFEQITFSAEQDARLQEISELSIPQGFQAQVREYVENGNFPEGYEHPLSDLKLKKERLQHQNDIDEAYQTILESEGLI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.