3300017919: Subsurface microbial communities from deep shales in Ohio, USA - hydraulic fracturing test GB_TM_B

Overview

Basic Information

• IMG/M Taxon OID: 3300017919
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118431 | Gp0208777 | Ga0182235
• Sample Name: Subsurface microbial communities from deep shales in Ohio, USA - hydraulic fracturing test GB_TM_B
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 29469814
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → planetary subsurface zone → fracking liquid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: USA: Ohio
• Coordinates
  • Lat. (^o): 40.178
  • Long. (^o): -81.073
  • Alt. (m): N/A
  • Depth (m): 2000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087432	Metagenome	110	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0182235_100107	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	28626

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0182235_100107	Ga0182235_10010726	F087432	MIIYENGEYTPCTYRVTLQNRGVEETHYANFRTHWEDMVAKHDHLTNLNFEQITFSAEQDARLQEISELSIPQGFQAQVREYVENGNFPEGYEHPLSDLKLKKERLQHQNDIDEAYQTILESEGLI