Basic Information | |
---|---|
Taxon OID | 3300017826 Open in IMG/M |
Scaffold ID | Ga0189785_1857 Open in IMG/M |
Source Dataset Name | Saline water viral communities from hypersaline Lake Retba, Senegal ? P6 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 551 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Saline Water → Archevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Retba, Senegal | |||||||
Coordinates | Lat. (o) | 14.8388 | Long. (o) | -17.2341 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056354 | Metagenome | 137 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0189785_18571 | F056354 | GGAGG | MILSVFIALSIMAVVTTGLAIRGDIPELLGAAVAAIMSIVAGINALDLFVITNSGGVKDIEPQTDIALILLVIFVINLIFIFDRAFSGGN |
⦗Top⦘ |