| Basic Information | |
|---|---|
| Taxon OID | 3300017826 Open in IMG/M |
| Scaffold ID | Ga0189785_1857 Open in IMG/M |
| Source Dataset Name | Saline water viral communities from hypersaline Lake Retba, Senegal ? P6 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 551 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Saline Water → Archevir - Metagenome And Diversity Of Hyperhalophilic Archaeoviruses |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Retba, Senegal | |||||||
| Coordinates | Lat. (o) | 14.8388 | Long. (o) | -17.2341 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056354 | Metagenome | 137 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0189785_18571 | F056354 | GGAGG | MILSVFIALSIMAVVTTGLAIRGDIPELLGAAVAAIMSIVAGINALDLFVITNSGGVKDIEPQTDIALILLVIFVINLIFIFDRAFSGGN |
| ⦗Top⦘ |