Scaffold Ga0182792_1001483

Overview

Basic Information

• Taxon OID: 3300017817
• Scaffold ID: Ga0182792_1001483
• Source Dataset Name: Cellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - Passage2 37B (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 18949
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Comparative Metagneomics Of Mesophilic And Thermophilic Cellulose-Adapted Consortia

Source Dataset Sampling Location

• Location Name: Emeryville, CA
• Coordinates
  • Lat. (^o): 37.840898
  • Long. (^o): -122.289614

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099155	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182792_100148315	F099155	N/A	MKSLERLVVTPEHFPLEITVSTGEKYLLPHPDHVQMHPNTRDLVIYPDEGPFSLVINPA