NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181402_1000472

Scaffold Ga0181402_1000472


Overview

Basic Information
Taxon OID3300017743 Open in IMG/M
Scaffold IDGa0181402_1000472 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15118
Total Scaffold Genes34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (17.65%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Associated Families5

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005287Metagenome / Metatranscriptome406Y
F016956Metagenome / Metatranscriptome243Y
F023615Metagenome / Metatranscriptome209Y
F025258Metagenome / Metatranscriptome202Y
F099289Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0181402_10004721F016956GGAMIELEKPWQAPKEVALAIMDLALTHIKKVESNPEVETEGDNFDYWNSYELEDGTFVDYNIHCGDEWTRLKQDGSGEYEYTDPSTWSWDVACYAVDPPNEEFQYHSIDTDREQYLFSYNKSYGNREVEFENVSL
Ga0181402_10004722F023615N/AMNRFELEDAMSDLHQIGEDIETIIYAIGDSPIEHTEDQLLNMLIGMKQLHDTRYQKMWGIFEQLIKNGTISNKGQQND
Ga0181402_100047220F099289N/AMIQIEDANNEVYYINPKNVIYVKKRKPMWKILLVNGEIIMTKNKEGAMAIVHAMLR
Ga0181402_100047224F005287N/AMRIKSSQIIYSEHGYDECFEYKDGSGRVPDGNAIGYEIHDNDLAGSFSRLILFEDITYSKYDHKYWDNLELENDEERLILP
Ga0181402_100047230F025258N/AMSEYKPKPFTKEIADEMKQIMESEFDDKRTLCNVLKLAYRCAKEESFNLEATRALLLEGLWMGQRMSDALTKKRKENFNSELPGQDEEEDPFAVDWSNLDGRNVSQGNWD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.