Scaffold Ga0187680_104703

Overview

Basic Information

• Taxon OID: 3300017603
• Scaffold ID: Ga0187680_104703
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in ASW medium, resuspended in ASW w/o silicate, 20 C, 29 psu salinity and 692 ?mol photons light - Chaetoceros curvisetus (MMETSP0717) (SRX549071-SRR1294457)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 650
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 32.9
  • Long. (^o): -117.255
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051162	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187680_1047032	F051162	N/A	IEMPLVKLFARKALSKPINLASIQSKLCTIWGTKPNTTKLILTKVDDWTDESFQEDVYVDIRAYGKPERTREMVLDGMEKVQGAFKDEGLIANVRLETYEGERYFHVPPKE