Scaffold Ga0187714_127616

Overview

Basic Information

• Taxon OID: 3300017558
• Scaffold ID: Ga0187714_127616
• Source Dataset Name: Metatranscriptome of freshwater eukaryotic communities from Lake Texoma, Oklahoma in f/2 medium with seawater, 18 C, 18 psu salinity and 200 ?mol photons light - Prymnesium parvum Texoma1 (MMETSP0008_2) (SRX549025-SRR1294411)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 506
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: USA: Lake Texoma, Oklahoma
• Coordinates
  • Lat. (^o): 33.98
  • Long. (^o): -96.67

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043734	Metagenome / Metatranscriptome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187714_1276161	F043734	N/A	AVSECTSRRQMNSFRAKQLLQPAARWGMTLGVVGFFLMYEDLPQLILQTPYGNFPGWEGVARHYGLLKPKE