Scaffold Ga0186425_110820

Overview

Basic Information

• Taxon OID: 3300017308
• Scaffold ID: Ga0186425_110820
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Gulf of Mexico in K medium w/o SiO2, 17 C, 30 psu salinity and 268 ?mol photons light - Hemiselmis andersenii CCMP 644 (MMETSP0043_2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 978
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Cryptophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020015	Metagenome / Metatranscriptome	226	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186425_1108201	F020015	N/A	DAVWELMVSPSPYSAVVSPDIGDKRRTQMMQAAVCTALALAAVVCVGLVVHERGSGAVGREELGGAYYAVAKPPAFNFNRFIRHAWVYDGRAADPDMTNFVQHVARKHHYKLQIHHLTSFRDNAFRAALFSENIHCIVFPPLVHFPGVSELAAKDLRGYVSAGNNAVFIGSYNWLSVMNDVFGFQLMSDYKDGPYYRNDRNVRGTPFQWSMNRLQQPDGSVYGVKVDSIPMDGKCMFDTMGACVVFYIKYNLGTVTYIAFDYDTPYGIDHWDQILHAGMMM