NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186684_116346

Scaffold Ga0186684_116346


Overview

Basic Information
Taxon OID3300017280 Open in IMG/M
Scaffold IDGa0186684_116346 Open in IMG/M
Source Dataset NameMetatranscriptome of coastal eukaryotic communities from Ligurian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 638 ?mol photons light - Strombidium inclinatum S3 (MMETSP0208)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)720
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameLigurian Sea
CoordinatesLat. (o)43.3Long. (o)10.2Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076114Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0186684_1163461F076114N/ADKMSGSDEAFLRFYESYARSPIDELQMTPREPGDFRERVPRETIKGRYAVFHNSIETYLYRHWRAFTVPRMAVFALGGYTLTMHGIFMFTHTFPNLTSYKSFAHHPNYKLLGSAWSWFYALRPVFWTYITFRLTRAVYYMSKRHWQGFDDQHGTMYSDTLYPDLFHDSDDQRYINFRYSDQKVVPEPLTGYYPHSFLRYGKWLAKKEETFFKNPNPPEKDSLAPIV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.