Scaffold Ga0186099_1037138

Overview

Basic Information

• Taxon OID: 3300017268
• Scaffold ID: Ga0186099_1037138
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from unknown location in L1 medium, at 15 C, 32 psu salinity and 608 ?mol photons light - Prymnesium polylepis CCMP 1757 (MMETSP0143)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 548
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Prymnesium → Prymnesium polylepis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043734	Metagenome / Metatranscriptome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186099_10371381	F043734	N/A	ARSAPSQMFTFFRAKQLGFPAARWGGAVGVIGFFLLYEDLPQLIMQTQYGVFPGWDGVAREFGLMAKKTEEE