Scaffold Ga0186431_114562

Overview

Basic Information

• Taxon OID: 3300017265
• Scaffold ID: Ga0186431_114562
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Gulf of Mexico in f/2 medium with silicate, 20 C, 21 psu salinity and 315 ?mol photons light - Stephanopyxis turris CCMP 815 (MMETSP0794_2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 739
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 29.4666
  • Long. (^o): -86.121

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051162	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186431_1145621	F051162	N/A	MPLVKIFARHSLSKHIPLPALQKSLCNIWGTKPNTTKLMLTRVEDWTDESFSEDCYVDIRAKGTPERTREAVLIGMKKVQEAFAEQDLIANIRLETYEGEGYFHVPPSS