Scaffold Ga0186220_110840

Overview

Basic Information

• Taxon OID: 3300017262
• Scaffold ID: Ga0186220_110840
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Tyrrhenian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 291 ?mol photons light - Pseudokeronopsis sp. OXSARD2 (MMETSP0211)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1020
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Tyrrhenian Sea
• Coordinates
  • Lat. (^o): 38.54
  • Long. (^o): 8.46

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039667	Metagenome / Metatranscriptome	163	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186220_1108401	F039667	GAG	MAFYGVGLDVKVRELNLQFKLTIQQKGGVGLRSLARIFKRMDFNGNKKLDA