Scaffold Ga0186463_111317

Overview

Basic Information

• Taxon OID: 3300017261
• Scaffold ID: Ga0186463_111317
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from English Channel in enriched f/2 medium with filtered seawater, 15 C, 35 psu salinity and 328 ?mol photons light - Coccolithus braarudii PLY182g (MMETSP0164_2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 901
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: English Channel
• Coordinates
  • Lat. (^o): 50.033
  • Long. (^o): 4.366
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024007	Metagenome / Metatranscriptome	207	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186463_1113172	F024007	N/A	LKIMAKAAPHAQPTNDGGIVVALVLLVAALASIFFGAVALYASADIVLTSEQKQKSVRARRLARLLSGWANVGNAAVHGLLIIMLVTDSERYKQFFPDEAEMPLGTAFMLVLNLLVGRCTLKGGGIVLALIWNSFVAVAGSLIPVVWPKFLDVGMITWPYLAVFLWLSIFAFESFAFFFSVVAFALKDAHAVKED