Scaffold Ga0186522_117063

Overview

Basic Information

• Taxon OID: 3300017260
• Scaffold ID: Ga0186522_117063
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 425 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0434)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 666
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 41.30051
  • Long. (^o): -71.71543
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047709	Metagenome / Metatranscriptome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186522_1170631	F047709	N/A	MKSFAFAGLTALALADKGSFPRDDSFHADCHVSAQFDGVSCDSLYALMDAEIRSWNSDTTSPSQGVYNLKEESVDDYIWSTRLTKNQKYTDDQLFEFASNDTGCAVTGRSRSQSMSYYDYSVNFCNLWNVYNGLNLTSYSVGKCGYPAKDPASTCAKY